Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TSG101 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99816
Molecular weight:
18.91 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Met1–Pro145
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TSG101 Protein, N-His

Product name ARO-P11560-100
Uniprot ID Q99816
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro145
Aliases /Synonyms Tumor susceptibility gene 101 protein, ESCRT-I complex subunit TSG101, TSG101
Reference ARO-P11560
Note For research use only.
Molecular Constructor
Met1–Pro145
Product name ARO-P11560-1MG
Uniprot ID Q99816
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro145
Aliases /Synonyms Tumor susceptibility gene 101 protein, ESCRT-I complex subunit TSG101, TSG101
Reference ARO-P11560
Note For research use only.
Molecular Constructor
Met1–Pro145
Product name ARO-P11560-50
Uniprot ID Q99816
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Molecular weight 18.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro145
Aliases /Synonyms Tumor susceptibility gene 101 protein, ESCRT-I complex subunit TSG101, TSG101
Reference ARO-P11560
Note For research use only.
Molecular Constructor
Met1–Pro145

Introduction

Recombinant Human TSG101 Protein (rTSG101) is a highly studied and widely used protein in the field of molecular biology. It is a member of the ESCRT-I (endosomal sorting complex required for transport) protein family and plays a crucial role in various cellular processes, including endosomal sorting, membrane trafficking, and cytokinesis. In this article, we will delve into the structure, activity, and application of rTSG101 protein in detail.

Structure of rTSG101 Protein

The rTSG101 protein is composed of 390 amino acids and has a molecular weight of 44 kDa. It is a cytoplasmic protein, which is predominantly expressed in the endosomal compartments of cells. The protein consists of several functional domains, including a ubiquitin-binding domain, a proline-rich domain, and a coiled-coil domain. These domains are essential for the protein’s role in endosomal sorting and membrane trafficking.

Activity of rTSG101 Protein

The primary function of rTSG101 protein is to facilitate the sorting of ubiquitinated cargo proteins into the multivesicular bodies (MVBs) for degradation. This process is crucial for maintaining cellular homeostasis and preventing the accumulation of damaged or unwanted proteins. The ubiquitin-binding domain of rTSG101 protein binds to the ubiquitin tags on the cargo proteins, while the coiled-coil domain interacts with other ESCRT proteins to form the ESCRT-I complex. This complex then recruits other ESCRT complexes to the endosomal membrane, leading to the formation of MVBs and subsequent degradation of the cargo proteins.

In addition to its role in endosomal sorting, rTSG101 protein also plays a crucial role in cytokinesis, the process of cell division. It is involved in the formation of the cytokinetic bridge, a structure that connects the two daughter cells during cell division. The proline-rich domain of rTSG101 protein interacts with other cytokinesis proteins, such as CEP55, to form the cytokinetic bridge. This ensures proper cell division and prevents the formation of multinucleated cells.

Application of rTSG101 Protein

The unique structure and activity of rTSG101 protein make it a valuable tool in various research applications. One of the most common uses of this protein is in studying the endosomal sorting pathway. Researchers can use rTSG101 protein to study the interactions between different ESCRT complexes and their role in endosomal sorting. This can provide valuable insights into the mechanisms of protein degradation and cellular homeostasis.

rTSG101 protein is also widely used in studying cytokinesis and cell division. Its role in forming the cytokinetic bridge and ensuring proper cell division makes it a valuable tool for researchers studying cell division processes.

Furthermore, rTSG101 protein has also been used in the development of therapeutic treatments for diseases such as HIV and cancer. As the protein is involved in the degradation of viral and oncogenic proteins, targeting rTSG101 can potentially inhibit the growth and spread of these diseases.

Conclusion

In conclusion, rTSG101 protein is a crucial player in the endosomal sorting pathway and cytokinesis. Its unique structure and activity make it a valuable tool for studying these cellular processes and developing therapeutic treatments. As research on this protein continues, we can expect to uncover more of its roles and potential applications in the field of molecular biology.

Recombinant Human TSG101 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TSG101 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products