Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TREM2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZC2
Molecular weight:
29.66 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
His19–Ser174
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TREM2 Protein, N-His-SUMO

Product name ARO-P10346-100
Uniprot ID Q9NZC2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His19-Ser174
Aliases /Synonyms Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference ARO-P10346
Note For research use only.
Molecular Constructor
His19–Ser174
Product name ARO-P10346-1MG
Uniprot ID Q9NZC2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His19-Ser174
Aliases /Synonyms Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference ARO-P10346
Note For research use only.
Molecular Constructor
His19–Ser174
Product name ARO-P10346-50
Uniprot ID Q9NZC2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His19-Ser174
Aliases /Synonyms Triggering receptor expressed on myeloid cells 2, Triggering receptor expressed on monocytes 2, TREM-2, TREM2
Reference ARO-P10346
Note For research use only.
Molecular Constructor
His19–Ser174

Introduction

Recombinant Human TREM2 (Triggering Receptor Expressed on Myeloid Cells 2) Protein is a protein that is produced through genetic engineering techniques in a laboratory setting. It is a soluble protein that is derived from the TREM2 gene, which is located on chromosome 6 in humans. This protein plays a crucial role in the immune system and has been linked to various diseases, making it a valuable tool in biomedical research and potential therapeutic applications.

Structure of Recombinant Human TREM2 Protein

The recombinant human TREM2 protein is composed of 230 amino acids with a molecular weight of approximately 25 kDa. It is a type I transmembrane protein, meaning that it spans the cell membrane with a short intracellular domain and a longer extracellular domain. The extracellular domain is where the protein interacts with other molecules and is responsible for its biological activity.

The extracellular domain of TREM2 contains an immunoglobulin-like domain and a stalk region. The immunoglobulin-like domain is responsible for binding to its ligands, while the stalk region provides flexibility for the protein to interact with other molecules. The intracellular domain of TREM2 is involved in signal transduction, which is necessary for the activation of immune cells.

Activity of Recombinant Human TREM2 Protein

The main function of TREM2 is to regulate the activity of immune cells, specifically myeloid cells such as macrophages and microglia. These cells play a crucial role in the immune response by engulfing and destroying foreign substances, damaged cells, and cellular debris. TREM2 acts as a receptor on the surface of these cells, binding to specific ligands and triggering a signaling cascade that leads to the activation of the cells.

Studies have shown that TREM2 is involved in various cellular processes, including phagocytosis, cell survival, and inflammation. It has also been linked to the regulation of lipid metabolism and the maintenance of brain function. Dysregulation of TREM2 has been implicated in several diseases, including Alzheimer’s disease, multiple sclerosis, and cancer.

Application of Recombinant Human TREM2 Protein

Recombinant Human TREM2 Protein has various applications in biomedical research and potential therapeutic interventions. It is commonly used as an antigen in studies to understand the role of TREM2 in different diseases. The recombinant protein can be used to generate antibodies that specifically target TREM2, allowing researchers to study its expression, function, and regulation in different cell types and disease models.

Additionally, recombinant human TREM2 protein can be used in drug discovery and development. As TREM2 is involved in the regulation of immune cells and inflammation, it has been identified as a potential target for therapeutic intervention in diseases such as Alzheimer’s and multiple sclerosis. Recombinant protein can be used to screen for small molecules or biologics that can modulate TREM2 activity and potentially treat these diseases.

Furthermore, recombinant human TREM2 protein can be used in the development of diagnostic tests for diseases that are associated with TREM2 dysregulation. By detecting the levels of TREM2 in biological samples, these tests can aid in the early diagnosis and monitoring of diseases such as Alzheimer’s and cancer.

Conclusion

In summary, Recombinant Human TREM2 Protein is a valuable tool in biomedical research and has potential applications in therapeutic interventions and diagnostics. Its unique structure and activity make it an essential protein in the regulation of immune cells and maintenance of cellular function. Further studies on TREM2 and its recombinant form will continue to expand our understanding of its role in health and disease.

Recombinant Human TREM2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TREM2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products