Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LMX1B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60663
Molecular weight:
16.05 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Cys56–Lys173
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LMX1B Protein, N-His

Product name ARO-P10814-100
Uniprot ID O60663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEK
Molecular weight 16.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys56-Lys173
Aliases /Synonyms LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1B, LIM homeobox transcription factor 1-beta, LMX-1.2
Reference ARO-P10814
Note For research use only.
Molecular Constructor
Cys56–Lys173
Product name ARO-P10814-1MG
Uniprot ID O60663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEK
Molecular weight 16.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys56-Lys173
Aliases /Synonyms LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1B, LIM homeobox transcription factor 1-beta, LMX-1.2
Reference ARO-P10814
Note For research use only.
Molecular Constructor
Cys56–Lys173
Product name ARO-P10814-50
Uniprot ID O60663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEK
Molecular weight 16.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys56-Lys173
Aliases /Synonyms LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1B, LIM homeobox transcription factor 1-beta, LMX-1.2
Reference ARO-P10814
Note For research use only.
Molecular Constructor
Cys56–Lys173

Introduction

Recombinant Human LMX1B Protein, also known as LIM homeobox transcription factor 1 beta, is a protein that plays a critical role in the development and function of various tissues and organs in the human body. This protein is encoded by the LMX1B gene and is involved in regulating gene expression, cell differentiation, and tissue formation. In this article, we will discuss the structure, activity, and applications of recombinant Human LMX1B Protein.

Structure of Recombinant Human LMX1B Protein

Recombinant Human LMX1B Protein is a transcription factor that belongs to the LIM homeobox family. It is composed of 402 amino acids and has a molecular weight of approximately 45 kDa. The protein contains two highly conserved LIM domains, which are involved in protein-protein interactions, and a homeobox domain, which is responsible for DNA binding and transcriptional regulation. The LIM domains are also important for the proper folding and stability of the protein.

Activity of Recombinant Human LMX1B Protein

Recombinant Human LMX1B Protein plays a crucial role in the development and function of various tissues and organs, including the central nervous system, kidney, and limb. It acts as a transcription factor, binding to specific DNA sequences and regulating the expression of target genes. This protein is involved in the development of dopaminergic neurons, which are important for motor control and coordination. It also plays a role in the formation of the glomerular basement membrane in the kidney, which is essential for proper kidney function. In addition, Recombinant Human LMX1B Protein is involved in the development of the limbs, specifically in the formation of bones and joints.

Application of Recombinant Human LMX1B Protein

Due to its critical role in various biological processes, Recombinant Human LMX1B Protein has been studied extensively and has potential applications in various fields.

Recombinant Protein Production

Recombinant Human LMX1B Protein can be produced in large quantities using recombinant DNA technology. This involves cloning the LMX1B gene into a suitable expression vector and expressing it in a host cell, such as E. coli or mammalian cells. The recombinant protein can then be purified and used for further studies or applications.

Antigen for Antibody Production

Recombinant Human LMX1B Protein can be used as an antigen to produce specific antibodies. These antibodies can then be used for various applications, such as Western blotting, immunohistochemistry, and immunofluorescence, to study the expression and localization of LMX1B in different tissues and cells.

Drug Development

As Recombinant Human LMX1B Protein is involved in the development and function of various tissues and organs, it has the potential to be a target for drug development. Modulating the activity of this protein could have therapeutic implications for diseases and disorders related to its function, such as Parkinson’s disease, kidney diseases, and limb malformations.

Research Tool

Recombinant Human LMX1B Protein can also serve as a valuable research tool for studying the function and regulation of this protein. It can be used in various in vitro and in vivo experiments to understand its role in development and disease.

Conclusion

In conclusion, Recombinant Human LMX1B Protein is a crucial protein involved in the development and function of various tissues and organs. Its structure, activity, and potential applications make it a valuable protein for further research and development. With ongoing studies and advancements in recombinant protein technology, the potential uses of Recombinant Human LMX1B Protein are likely to expand, leading to new insights and potential therapeutic options for various diseases and disorders.

Recombinant Human LMX1B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human LMX1B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products