Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMLHE Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NVH6
Molecular weight:
33.76 kDa

Original price was: €314.00.Current price is: €275.00.

100ug 12% OFF + 275 loyalty points
Asn153–Ala421
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMLHE Protein, N-His

Product name ARO-P11176-100
Uniprot ID Q9NVH6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTARLLGLQA
Molecular weight 33.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn153-Ala421
Aliases /Synonyms TML hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, TML dioxygenase, TMLD, TML-alpha-ketoglutarate dioxygenase, TMLHE, Trimethyllysine dioxygenase, mitochondrial, Epsilon-trimethyllysine hydroxylase, TMLH
Reference ARO-P11176
Note For research use only.
Molecular Constructor
Asn153–Ala421
Product name ARO-P11176-1MG
Uniprot ID Q9NVH6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTARLLGLQA
Molecular weight 33.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn153-Ala421
Aliases /Synonyms TML hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, TML dioxygenase, TMLD, TML-alpha-ketoglutarate dioxygenase, TMLHE, Trimethyllysine dioxygenase, mitochondrial, Epsilon-trimethyllysine hydroxylase, TMLH
Reference ARO-P11176
Note For research use only.
Molecular Constructor
Asn153–Ala421
Product name ARO-P11176-50
Uniprot ID Q9NVH6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTARLLGLQA
Molecular weight 33.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn153-Ala421
Aliases /Synonyms TML hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, TML dioxygenase, TMLD, TML-alpha-ketoglutarate dioxygenase, TMLHE, Trimethyllysine dioxygenase, mitochondrial, Epsilon-trimethyllysine hydroxylase, TMLH
Reference ARO-P11176
Note For research use only.
Molecular Constructor
Asn153–Ala421

Introduction to Recombinant Human TMLHE Protein

Recombinant Human TMLHE Protein is a highly purified and bioactive protein that is produced through recombinant DNA technology. This protein plays a crucial role in the metabolism of the amino acid L-carnitine, which is essential for energy production and fatty acid metabolism in the body. TMLHE stands for Trimethyllysine Hydroxylase, and this enzyme is responsible for converting trimethyllysine (TML) into hydroxytrimethyllysine (HTML), a key step in the L-carnitine biosynthetic pathway.

Structure of Recombinant Human TMLHE Protein

Recombinant Human TMLHE Protein is a 46 kDa protein consisting of 417 amino acids. It belongs to the Fe(II)/2-oxoglutarate-dependent dioxygenase family and contains a conserved catalytic domain that is essential for its enzymatic activity. The protein also contains a C-terminal transmembrane domain, which anchors it to the endoplasmic reticulum membrane, where it carries out its function.

Activity of Recombinant Human TMLHE Protein

The main activity of Recombinant Human TMLHE Protein is the hydroxylation of trimethyllysine, a byproduct of protein breakdown, to form hydroxytrimethyllysine. This reaction is essential for the biosynthesis of L-carnitine, which is a vital nutrient for energy production and fatty acid metabolism in the body. The hydroxylation reaction is catalyzed by the Fe(II)/2-oxoglutarate-dependent dioxygenase domain of the protein, which requires oxygen and 2-oxoglutarate as co-substrates.

In addition to its role in L-carnitine biosynthesis, Recombinant Human TMLHE Protein has also been shown to play a role in the regulation of cholesterol metabolism. It has been found that the protein can hydroxylate cholesterol intermediates, which may have implications in the development of atherosclerosis and other cardiovascular diseases.

Applications of Recombinant Human TMLHE Protein

Recombinant Human TMLHE Protein has a wide range of applications in both research and therapeutic settings. Some of the key applications include:

1. Study of L-carnitine metabolism

Recombinant Human TMLHE Protein is an essential tool for studying the biosynthesis of L-carnitine and its role in energy production and fatty acid metabolism. By inhibiting or overexpressing the protein, researchers can gain a better understanding of the biochemical pathways involved in L-carnitine metabolism and its regulation.

2. Development of diagnostic tests

Deficiency of TMLHE activity is a rare inherited disorder that results in the inability to produce L-carnitine, leading to a range of symptoms including muscle weakness and fatigue. Recombinant Human TMLHE Protein can be used to develop diagnostic tests for this disorder, allowing for early detection and treatment.

3. Production of therapeutic agents

Recombinant Human TMLHE Protein has potential therapeutic applications in the treatment of disorders related to L-carnitine deficiency, such as cardiovascular diseases and metabolic disorders. It can also be used to develop novel drugs that target the enzyme and its activity, providing new treatment options for these conditions.

4. Vaccine development

Recombinant Human TMLHE Protein has been identified as a potential antigen for the development of vaccines against atherosclerosis and other cardiovascular diseases. By targeting the protein, researchers hope to stimulate an immune response that can prevent or reduce the buildup of cholesterol in the arteries, reducing the risk of heart disease.

5. Biotechnology applications

Recombinant Human T

Recombinant Human TMLHE Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TMLHE Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products