Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMED9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BVK6
Molecular weight:
14.79 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Leu38–Gly146
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMED9 Protein, N-His

Product name ARO-P10687-100
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146
Product name ARO-P10687-1MG
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146
Product name ARO-P10687-50
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146

Introduction

Recombinant Human TMED9 Protein, also known as Transmembrane Emp24 Domain-Containing Protein 9, is a protein that plays a crucial role in the transport of cargo proteins from the endoplasmic reticulum (ER) to the Golgi apparatus. This protein is encoded by the TMED9 gene and is a member of the EMP24/GP25L family of proteins. In this article, we will discuss the structure, activity, and applications of Recombinant Human TMED9 Protein.

Structure of Recombinant Human TMED9 Protein

Recombinant Human TMED9 Protein is a transmembrane protein that is composed of 197 amino acids. It has a molecular weight of approximately 22 kDa and is highly conserved among different species. The protein contains a transmembrane domain at the N-terminus and a cytoplasmic domain at the C-terminus. The cytoplasmic domain contains a dilysine motif that is essential for the retrieval of cargo proteins from the Golgi apparatus back to the ER. The protein also has four transmembrane helices and two extracellular loops. The structure of Recombinant Human TMED9 Protein is important for its function in cargo protein transport.

Activity of Recombinant Human TMED9 Protein

Recombinant Human TMED9 Protein is primarily involved in the transport of cargo proteins from the ER to the Golgi apparatus. It functions as a receptor in the COPII-mediated vesicle transport pathway. This protein interacts with the cargo proteins through its cytoplasmic domain and facilitates their packaging into COPII-coated vesicles. These vesicles then fuse with the Golgi apparatus, releasing the cargo proteins into the Golgi lumen. Recombinant Human TMED9 Protein also plays a role in the retrieval of cargo proteins from the Golgi apparatus back to the ER. The dilysine motif in its cytoplasmic domain binds to COPI-coated vesicles, which transport the cargo proteins back to the ER. This process ensures proper localization and function of cargo proteins within the cell.

Applications of Recombinant Human TMED9 Protein

Recombinant Human TMED9 Protein has various applications in the field of biotechnology and medicine. One of its main applications is in the production of recombinant proteins. The protein’s role in cargo protein transport makes it a valuable tool for the efficient production of recombinant proteins in mammalian cells. By overexpressing Recombinant Human TMED9 Protein, the transport of recombinant proteins from the ER to the Golgi apparatus can be enhanced, resulting in higher yields of the desired protein.

Another application of Recombinant Human TMED9 Protein is in the study of protein trafficking and secretion. The protein’s involvement in the COPII-mediated vesicle transport pathway makes it a useful tool for understanding the mechanisms of protein transport within cells. By studying the effects of Recombinant Human TMED9 Protein on cargo protein trafficking, researchers can gain insights into the regulation of this process and its role in various cellular functions.

Furthermore, Recombinant Human TMED9 Protein has also been studied for its potential role in cancer progression. It has been found to interact with the tumor suppressor protein p53, suggesting a possible involvement in regulating cell growth and proliferation. Further research is needed to fully understand the implications of this interaction and its potential as a therapeutic target for cancer treatment.

Conclusion

In conclusion, Recombinant Human TMED9 Protein is a transmembrane protein that plays a crucial role in the transport of cargo proteins from the ER to the Golgi apparatus. Its structure, activity, and applications make it a valuable tool for various scientific studies and biotechnological applications. Further research on this protein may lead to a better understanding of its role in cellular processes and its potential as a therapeutic target for various diseases.

Recombinant Human TMED9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TMED9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products