Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TCL1A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P56279
Molecular weight:
15.77 kDa

Original price was: €347.00.Current price is: €275.00.

100ug 21% OFF + 275 loyalty points
His Met1–Asp114
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TCL1A, N-His

Product name ARO-P13609-100
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114
Product name ARO-P13609-1MG
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114
Product name ARO-P13609-50
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114

Title: Introduction to Recombinant Human TCL1A

Recombinant Human TCL1A, also known as T-cell leukemia/lymphoma 1A, is a protein that plays a crucial role in regulating the development and function of T-cells in the immune system. This protein is encoded by the TCL1A gene and is expressed primarily in T-cells, but can also be found in other immune cells such as B-cells and natural killer cells.

Structure of Recombinant Human TCL1A

Recombinant Human TCL1A is a small protein consisting of 123 amino acids with a molecular weight of approximately 14 kDa. It contains a conserved N-terminal domain and a C-terminal domain that is highly variable among different species. The N-terminal domain is responsible for the interaction with other proteins, while the C-terminal domain is involved in the regulation of TCL1A activity.

Activity of Recombinant Human TCL1A

Recombinant Human TCL1A is a potent activator of the PI3K/Akt signaling pathway, which is essential for T-cell survival, proliferation, and differentiation. This protein binds to the regulatory subunit of PI3K, p85, and enhances its activity, leading to the activation of downstream signaling molecules such as Akt and mTOR. Through this pathway, Recombinant Human TCL1A promotes the survival and growth of T-cells.

In addition, Recombinant Human TCL1A also regulates the expression of various cytokines, including IL-2, IL-4, and IL-10, which are important for T-cell function. It also plays a role in the development and maintenance of memory T-cells, which are crucial for long-term immunity.

Application of Recombinant Human TCL1A

Recombinant Human TCL1A has been extensively studied for its potential therapeutic applications in various diseases, particularly in cancer. Due to its role in promoting cell survival and growth, this protein has been implicated in the development and progression of several types of cancers, including T-cell lymphomas, B-cell lymphomas, and leukemias.

One of the most promising applications of Recombinant Human TCL1A is in the treatment of T-cell acute lymphoblastic leukemia (T-ALL). It has been shown that TCL1A is overexpressed in T-ALL cells and contributes to the survival and proliferation of these cancer cells. Inhibiting the activity of Recombinant Human TCL1A has been shown to induce cell death in T-ALL cells, making it a potential target for novel cancer therapies.

Moreover, Recombinant Human TCL1A has also been studied for its role in autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis. It has been shown that this protein is involved in the development of autoimmunity by promoting the survival of autoreactive T-cells. Inhibiting the activity of Recombinant Human TCL1A may therefore have potential therapeutic benefits in these diseases.

Conclusion

In summary, Recombinant Human TCL1A is a small protein that plays a critical role in regulating T-cell function and survival through the activation of the PI3K/Akt signaling pathway. Its overexpression has been linked to various diseases, particularly cancer, making it a potential target for therapeutic interventions. Further research on the structure and activity of Recombinant Human TCL1A may provide valuable insights into its role in disease development and lead to the development of novel treatments.

Recombinant Human TCL1A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TCL1A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products