Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ST6GALNAC6/Sialyltransferase 7F, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q969X2
Molecular weight:
33.06 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Val67–Thr333
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ST6GALNAC6/Sialyltransferase 7F, N-His

Product name ARO-P13189-100
Uniprot ID Q969X2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Molecular weight 33.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val67-Thr333
Aliases /Synonyms hST6GalNAc VI, SIAT7-F, Sialyltransferase 7F, ST6GalNAcVI, SIAT7F, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, GalNAc alpha-2,6-sialyltransferase VI, ST6GalNAc VI, ST6GALNAC6
Reference ARO-P13189
Note For research use only.
Molecular Constructor
Val67–Thr333
Product name ARO-P13189-1MG
Uniprot ID Q969X2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Molecular weight 33.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val67-Thr333
Aliases /Synonyms hST6GalNAc VI, SIAT7-F, Sialyltransferase 7F, ST6GalNAcVI, SIAT7F, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, GalNAc alpha-2,6-sialyltransferase VI, ST6GalNAc VI, ST6GALNAC6
Reference ARO-P13189
Note For research use only.
Molecular Constructor
Val67–Thr333
Product name ARO-P13189-50
Uniprot ID Q969X2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Molecular weight 33.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val67-Thr333
Aliases /Synonyms hST6GalNAc VI, SIAT7-F, Sialyltransferase 7F, ST6GalNAcVI, SIAT7F, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, GalNAc alpha-2,6-sialyltransferase VI, ST6GalNAc VI, ST6GALNAC6
Reference ARO-P13189
Note For research use only.
Molecular Constructor
Val67–Thr333

Recombinant Human ST6GALNAC6/Sialyltransferase 7F, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ST6GALNAC6/Sialyltransferase 7F, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products