Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SORBS1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BX66
Molecular weight:
20.51 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Thr773–Pro929
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SORBS1 Protein, N-His

Product name ARO-P11225-100
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929
Product name ARO-P11225-1MG
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929
Product name ARO-P11225-50
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929

Introduction

Recombinant Human SORBS1 Protein is a highly versatile protein that has gained significant attention in the scientific community due to its unique structure and diverse functions. This protein is a recombinant form of the human SORBS1 (sorbin and SH3 domain-containing protein 1) gene, which encodes for a cytoskeletal protein involved in cell adhesion, migration, and signaling. In this article, we will delve into the structure, activity, and application of this recombinant protein.

Structure of Recombinant Human SORBS1 Protein

Recombinant Human SORBS1 Protein is a 110 kDa protein consisting of 1053 amino acids. It contains three distinct domains, including an N-terminal sorbin homology (SoHo) domain, a central SH3 domain, and a C-terminal proline-rich region. The SoHo domain is responsible for binding to actin filaments, while the SH3 domain interacts with various signaling proteins. The proline-rich region serves as a docking site for other proteins, allowing for the formation of multiprotein complexes.

Activity of Recombinant Human SORBS1 Protein

Recombinant Human SORBS1 Protein is involved in a wide range of cellular processes, making it a crucial player in cell biology. One of its main functions is to regulate cell adhesion and migration by binding to actin filaments and promoting the formation of focal adhesions. These structures are essential for cell attachment to the extracellular matrix and play a critical role in cell movement. Additionally, this protein has been shown to modulate signaling pathways by interacting with various proteins, including tyrosine kinases and GTPases.

Application of Recombinant Human SORBS1 Protein

Due to its diverse functions, Recombinant Human SORBS1 Protein has a wide range of applications in both basic research and clinical settings. In research, this protein is commonly used as an antigen for the production of antibodies that can be used to study its expression and localization in different cell types. It is also used in cell culture experiments to investigate its role in cell adhesion and migration.

In the clinical setting, Recombinant Human SORBS1 Protein has shown potential as a diagnostic and therapeutic target for various diseases. Studies have shown that alterations in the expression of this protein are associated with several types of cancer, making it a potential biomarker for early detection and prognosis. Additionally, this protein has been implicated in cardiovascular diseases, making it a potential target for drug development.

Conclusion

In summary, Recombinant Human SORBS1 Protein is a multifunctional protein with a unique structure that allows it to play diverse roles in cellular processes. Its ability to regulate cell adhesion, migration, and signaling makes it a crucial player in cell biology. With its wide range of applications in research and potential clinical implications, this protein continues to be a subject of interest for scientists and researchers in various fields.

Recombinant Human SORBS1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SORBS1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products