Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNU13 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55769
Molecular weight:
16.34 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Met1–Val128
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNU13 Protein, N-His

Product name ARO-P11994-100
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128
Product name ARO-P11994-1MG
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128
Product name ARO-P11994-50
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128

Introduction to Recombinant Human SNU13 Protein

Recombinant proteins are proteins that are produced through genetic engineering techniques, where a specific gene is inserted into a host organism, such as bacteria or yeast, to produce a large amount of the desired protein. Recombinant proteins have become an essential tool in various fields of research, including medicine, biotechnology, and biochemistry.

One such recombinant protein is the Recombinant Human SNU13 Protein, which has gained significant attention in recent years due to its unique structure, diverse functions, and potential applications. In this article, we will delve into the details of this protein, including its structure, activity, and potential applications.

Structure of Recombinant Human SNU13 Protein

The Recombinant Human SNU13 Protein, also known as small nuclear ribonucleoprotein-associated protein N, is a 13 kDa protein that is encoded by the SNU13 gene located on chromosome 12 in humans. This protein is highly conserved among eukaryotes, with a 100% sequence identity between human and yeast SNU13 proteins.

The protein is composed of 116 amino acids and has a unique structure consisting of two domains, an N-terminal domain, and a C-terminal domain. The N-terminal domain is responsible for binding to RNA, while the C-terminal domain interacts with other proteins, such as small nuclear ribonucleoproteins (snRNPs), to form the core of the spliceosome complex.

The structure of Recombinant Human SNU13 Protein has been extensively studied using X-ray crystallography, which has revealed its compact and globular shape. The protein is also known to undergo post-translational modifications, such as phosphorylation and acetylation, which can affect its activity and function.

Activity of Recombinant Human SNU13 Protein

The primary function of Recombinant Human SNU13 Protein is in pre-mRNA splicing, a crucial process in gene expression that involves removing introns and joining exons to form mature mRNA. This protein plays a vital role in this process by stabilizing the interaction between snRNPs and pre-mRNA, thereby facilitating the formation of the spliceosome complex.

Additionally, Recombinant Human SNU13 Protein has been shown to interact with other proteins involved in RNA processing, such as RNA helicases, suggesting its involvement in other RNA-related activities. It has also been reported to have a role in regulating mRNA stability and translation, further highlighting its diverse functions.

The activity of Recombinant Human SNU13 Protein is also influenced by its binding to specific RNA sequences, such as the stem-loop structure found in the U4 snRNA. This binding has been shown to enhance the stability of the spliceosome complex, thus promoting efficient pre-mRNA splicing.

Applications of Recombinant Human SNU13 Protein

Given its crucial role in pre-mRNA splicing and other RNA-related activities, Recombinant Human SNU13 Protein has potential applications in various fields of research and medicine.

One of the primary applications of this protein is in the study of pre-mRNA splicing and the spliceosome complex. Recombinant Human SNU13 Protein can be used to investigate the mechanism of splicing and its regulation, as well as to identify potential therapeutic targets for diseases associated with splicing defects, such as cancer.

Moreover, Recombinant Human SNU13 Protein has been used in the development of diagnostic tools for detecting RNA-related diseases. For example, its interaction with specific RNA sequences can be utilized to design probes for detecting RNA biomarkers in diseases such as Alzheimer’s and Parkinson’s.

Furthermore, Recombinant Human SNU13 Protein has potential applications in biotechnology, such as in the production of recombinant proteins. Its high affinity for RNA can be exploited to develop RNA-protein fusion tags for protein purification

Recombinant Human SNU13 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SNU13 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products