Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMARCC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92922
Molecular weight:
30.16 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Thr40–Asn277
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMARCC1 Protein, N-His

Product name ARO-P12028-100
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277
Product name ARO-P12028-1MG
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277
Product name ARO-P12028-50
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277

Introduction

Recombinant Human SMARCC1 Protein, also known as SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, is a protein that plays a crucial role in chromatin remodeling and gene expression. It is a highly conserved protein found in all eukaryotic organisms and is essential for various cellular processes such as development, differentiation, and DNA repair.

Structure of Recombinant Human SMARCC1 Protein

Recombinant Human SMARCC1 Protein is composed of 1,018 amino acids and has a molecular weight of approximately 115 kDa. It belongs to the SWI/SNF family of proteins, which are characterized by the presence of a highly conserved ATPase domain. The protein also contains a bromodomain, a DNA-binding domain, and a helicase domain, all of which are important for its function in chromatin remodeling.

Activity of Recombinant Human SMARCC1 Protein

Recombinant Human SMARCC1 Protein is a key component of the SWI/SNF chromatin remodeling complex. This complex is responsible for altering the structure of chromatin, the complex of DNA and proteins that make up the chromosomes. It does so by using the energy from ATP hydrolysis to move, eject, or restructure nucleosomes, the basic units of chromatin. SMARCC1 acts as a bridge between the ATPase subunits and other components of the SWI/SNF complex, facilitating its function in chromatin remodeling.

In addition to its role in chromatin remodeling, SMARCC1 also plays a role in transcriptional regulation. It interacts with transcription factors and other regulatory proteins to control the expression of genes. This activity is crucial for the proper development and differentiation of cells, as well as for maintaining normal cellular functions.

Application of Recombinant Human SMARCC1 Protein

Recombinant Human SMARCC1 Protein has a wide range of applications in both basic and applied research. It is commonly used as an antigen in studies investigating the function and regulation of the SWI/SNF complex. The protein can be produced in large quantities using recombinant DNA technology, making it readily available for research purposes.

One major application of Recombinant Human SMARCC1 Protein is in cancer research. The SWI/SNF complex has been found to be frequently mutated in various types of cancers, and SMARCC1 is one of the most commonly affected subunits. By studying the structure and function of this protein, researchers can gain a better understanding of how these mutations contribute to cancer development and progression. Additionally, SMARCC1 has been identified as a potential therapeutic target for cancer treatment, making it a promising area of research for drug development.

Recombinant Human SMARCC1 Protein is also used in studies related to neurological disorders. The SWI/SNF complex has been implicated in the regulation of gene expression in the brain, and mutations in SMARCC1 have been associated with intellectual disability and neurodevelopmental disorders. By studying the function and activity of this protein, researchers can gain insights into the molecular mechanisms underlying these disorders and potentially identify new therapeutic targets.

Conclusion

In summary, Recombinant Human SMARCC1 Protein is a crucial component of the SWI/SNF chromatin remodeling complex and plays a vital role in various cellular processes. Its structure and activity make it an important tool for studying chromatin remodeling and gene regulation in both normal and disease states. With its wide range of applications, this protein continues to be an essential tool in advancing our understanding of cellular biology and disease mechanisms.

Recombinant Human SMARCC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMARCC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products