Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC22A6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q4U2R8
Molecular weight:
22.34 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Thr41–Arg131
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC22A6 Protein, N-His-SUMO

Product name ARO-P12049-100
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131
Product name ARO-P12049-1MG
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131
Product name ARO-P12049-50
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131

Introduction

Recombinant Human SLC22A6 Protein, also known as Organic Anion Transporter 1 (OAT1), is a membrane protein that plays a crucial role in the transport of organic anions across cell membranes. This protein is encoded by the SLC22A6 gene and is primarily expressed in the kidney, where it is responsible for the uptake and elimination of various endogenous and exogenous substances.

Structure of Recombinant Human SLC22A6 Protein

The recombinant form of SLC22A6 protein is a single polypeptide chain consisting of 554 amino acids. It has a predicted molecular mass of approximately 61 kDa and contains 12 putative transmembrane domains. The protein has a large extracellular loop between transmembrane domains 1 and 2, which is believed to be the binding site for organic anions. The cytoplasmic C-terminus of the protein contains several phosphorylation sites that regulate its activity.

Activity of Recombinant Human SLC22A6 Protein

Recombinant Human SLC22A6 Protein is a member of the SLC22 family of transporters, which are responsible for the transport of a variety of organic anions and cations. This protein specifically transports organic anions, such as endogenous compounds like urate, prostaglandins, and bile acids, as well as exogenous substances like antibiotics and non-steroidal anti-inflammatory drugs (NSAIDs).

The activity of Recombinant Human SLC22A6 Protein is regulated by several factors, including the concentration of substrates, pH, and the presence of other transporters. It functions as a symporter, using the electrochemical gradient of sodium ions to drive the transport of organic anions into the cell. This process is essential for the excretion of these substances from the body, as well as for maintaining their homeostasis.

Application of Recombinant Human SLC22A6 Protein

Recombinant Human SLC22A6 Protein has various applications in both research and clinical settings. Its role in the transport of endogenous and exogenous substances makes it a valuable tool for studying drug interactions, as well as for understanding the mechanisms of drug-induced toxicity. Additionally, mutations in the SLC22A6 gene have been linked to certain diseases, such as gout and chronic kidney disease, making this protein a potential therapeutic target.

In research, Recombinant Human SLC22A6 Protein is commonly used in in vitro and in vivo studies to investigate the transport and metabolism of various compounds. Its expression in the kidney also makes it a useful tool for studying the renal handling of drugs and other substances.

In the clinical setting, Recombinant Human SLC22A6 Protein can be used to develop diagnostic tests for diseases associated with mutations in the SLC22A6 gene. It can also be used to screen for potential drug interactions and to develop personalized treatment plans for patients.

Conclusion

In conclusion, Recombinant Human SLC22A6 Protein is a crucial membrane protein involved in the transport of organic anions across cell membranes. Its structure, activity, and applications make it a valuable tool in both research and clinical settings. Further studies on this protein may provide a better understanding of its role in drug metabolism and the development of targeted therapies for various diseases.

Recombinant Human SLC22A6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLC22A6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products