Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SERPINA12, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IW75
Molecular weight:
37.43 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Asn52–Arg143
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SERPINA12, N-GST

Product name ARO-P12901-100
Uniprot ID Q8IW75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQR
Molecular weight 37.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn52-Arg143
Aliases /Synonyms Vaspin, Visceral adipose-specific serpin, Visceral adipose tissue-derived serine protease inhibitor, OL-64, Serpin A12, SERPINA12
Reference ARO-P12901
Note For research use only.
Molecular Constructor
Asn52–Arg143
Product name ARO-P12901-1MG
Uniprot ID Q8IW75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQR
Molecular weight 37.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn52-Arg143
Aliases /Synonyms Vaspin, Visceral adipose-specific serpin, Visceral adipose tissue-derived serine protease inhibitor, OL-64, Serpin A12, SERPINA12
Reference ARO-P12901
Note For research use only.
Molecular Constructor
Asn52–Arg143
Product name ARO-P12901-50
Uniprot ID Q8IW75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQR
Molecular weight 37.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn52-Arg143
Aliases /Synonyms Vaspin, Visceral adipose-specific serpin, Visceral adipose tissue-derived serine protease inhibitor, OL-64, Serpin A12, SERPINA12
Reference ARO-P12901
Note For research use only.
Molecular Constructor
Asn52–Arg143

The Structure and Activity of Recombinant Human SERPINA12

Recombinant Human SERPINA12, also known as Vaspin, is a protein that plays a crucial role in regulating glucose and lipid metabolism in the body. It is a member of the serine protease inhibitor (serpin) family and is encoded by the SERPINA12 gene.

Structure of Recombinant Human SERPINA12

The recombinant form of SERPINA12 is a single-chain glycoprotein with a molecular weight of approximately 45 kDa. It is composed of 396 amino acids and has a predicted isoelectric point of 5.8. The protein contains several conserved regions, including a reactive center loop (RCL) and a serpin domain, which are essential for its inhibitory activity.

The crystal structure of recombinant human SERPINA12 has been determined, revealing its unique conformation. The protein has a characteristic serpin fold, with three beta-sheets and nine alpha-helices. The RCL is located at the top of the molecule and is able to undergo a conformational change upon binding to its target protease.

Activity of Recombinant Human SERPINA12

Recombinant Human SERPINA12 is a potent inhibitor of several serine proteases, including trypsin, chymotrypsin, and elastase. It works by binding to the active site of these enzymes, forming a covalent bond and irreversibly inhibiting their activity. This mechanism of action is similar to other serpins, such as alpha-1 antitrypsin.

In addition to its protease inhibitory activity, recombinant human SERPINA12 has been shown to have other functions in the body. It has been found to play a role in insulin sensitivity and glucose metabolism, as well as in the regulation of adipogenesis and inflammation. Studies have also suggested that it may have a protective effect against obesity and type 2 diabetes.

Application of Recombinant Human SERPINA12

The potential therapeutic applications of recombinant human SERPINA12 are vast, given its diverse functions in the body. It has been studied for its potential use in treating obesity, insulin resistance, and type 2 diabetes. Some studies have also suggested its potential as a biomarker for these conditions, as well as for cardiovascular disease.

Recombinant human SERPINA12 has also been investigated for its role in cancer. It has been found to inhibit the growth and metastasis of certain types of cancer cells, making it a potential target for cancer therapy. Additionally, it has been studied for its potential use in treating neurodegenerative diseases, such as Alzheimer’s and Parkinson’s.

The recombinant protein has also been used in research to study the role of SERPINA12 in various physiological processes. It has been used to investigate its function in adipose tissue, the liver, and the pancreas. Additionally, it has been used to study its potential as a biomarker for various diseases and conditions.

Conclusion

In summary, recombinant human SERPINA12 is a unique protein with diverse functions in the body. Its structure, activity, and potential applications make it a promising target for therapeutic interventions and a valuable tool for scientific research. Further studies are needed to fully understand the role of this protein in various physiological processes and to explore its potential for clinical use.

Recombinant Human SERPINA12, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human SERPINA12, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products