Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL36B/IL-1F8, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZH7
Molecular weight:
20.35 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Arg5–Met164
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL36B/IL-1F8, N-His

Product name ARO-P13052-100
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164
Product name ARO-P13052-1MG
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164
Product name ARO-P13052-50
Uniprot ID Q9NZH7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Molecular weight 20.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg5-Met164
Aliases /Synonyms Interleukin-1 family member 8, Interleukin-1 homolog 2, IL36B, IL1H2, Interleukin-1 eta, FIL1 eta, IL-1H2, IL-1F8, Interleukin-36 beta, IL1F8, IL-1 eta
Reference ARO-P13052
Note For research use only.
Molecular Constructor
Arg5–Met164

Introduction

Recombinant Human IL36B, also known as IL-1F8, is a cytokine that belongs to the interleukin-1 (IL-1) family of proteins. It is produced by immune cells, such as monocytes, macrophages, and dendritic cells, and plays a crucial role in the regulation of inflammatory and immune responses. In this article, we will explore the structure, activity, and applications of Recombinant Human IL36B in detail.

Structure of Recombinant Human IL36B

Recombinant Human IL36B is a glycoprotein with a molecular weight of approximately 17 kDa. It is composed of 157 amino acids and contains a signal peptide at the N-terminus, which is cleaved during protein maturation. The mature form of IL36B consists of two domains: an N-terminal domain (NTD) and a C-terminal domain (CTD). The NTD contains four alpha helices, which are responsible for binding to the IL-36 receptor (IL-36R). The CTD contains a beta-trefoil fold, which is responsible for binding to the IL-1 receptor accessory protein (IL-1RAcP). This interaction between IL36B and its receptors is essential for its biological activity.

Activity of Recombinant Human IL36B

Recombinant Human IL36B is a proinflammatory cytokine that acts as an agonist for the IL-36 receptor complex, which consists of IL-36R and IL-1RAcP. Upon binding to its receptors, IL36B induces the production of other proinflammatory cytokines, such as IL-6, IL-8, and TNF-alpha, by activating the NF-kappaB and MAPK signaling pathways. This results in the recruitment and activation of immune cells, leading to inflammation and tissue damage.

IL36B is also involved in the regulation of adaptive immune responses. It can enhance the production of Th1 and Th17 cytokines, which are important for the activation of T cells and the differentiation of B cells. In addition, IL36B can also induce the expression of co-stimulatory molecules on antigen-presenting cells, which are essential for the activation of T cells.

Applications of Recombinant Human IL36B

Due to its proinflammatory and immunoregulatory properties, Recombinant Human IL36B has been studied extensively for its potential therapeutic applications. Some of the key areas of research include:

Autoimmune Diseases

IL36B has been shown to play a role in the pathogenesis of autoimmune diseases, such as psoriasis, rheumatoid arthritis, and systemic lupus erythematosus. Therefore, targeting IL36B could be a potential therapeutic strategy for these diseases. In fact, preclinical studies have shown promising results in animal models of psoriasis, where IL36B blockade reduced skin inflammation and improved disease symptoms.

Inflammatory Disorders

IL36B has also been implicated in various inflammatory disorders, such as inflammatory bowel disease, asthma, and chronic obstructive pulmonary disease. In these conditions, IL36B contributes to tissue damage and inflammation. Therefore, targeting IL36B could potentially alleviate symptoms and improve disease outcomes.

Infectious Diseases

IL36B has been shown to play a role in the immune response against infectious diseases, such as viral and bacterial infections. Recombinant Human IL36B has been studied as a potential therapeutic agent for these infections, either alone or in combination with other treatments.

Cancer

Recent studies have also shown that IL36B may have anti-tumor effects by promoting the activation of immune cells and inhibiting tumor growth. This has led to the investigation of IL36B as a potential immunotherapy for cancer treatment.

Conclusion

In summary, Recombinant Human IL36B is a cytokine with diverse biological activities, including proinflammatory and immunoreg

Recombinant Human IL36B/IL-1F8, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL36B/IL-1F8, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products