Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RARG Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P13631
Molecular weight:
30.15 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Asp178–Glu423
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RARG Protein, N-His

Product name ARO-P10799-100
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423
Product name ARO-P10799-1MG
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423
Product name ARO-P10799-50
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423

Introduction

Recombinant Human RARG Protein, also known as Retinoic Acid Receptor Gamma, is a protein that plays a crucial role in the regulation of gene expression and cellular differentiation. It is a member of the retinoic acid receptor (RAR) family, which includes RARA and RARB. RARG is encoded by the RARG gene and is found in various tissues and organs, including the brain, liver, and reproductive organs. In this article, we will discuss the structure, activity, and applications of Recombinant Human RARG Protein.

Structure of Recombinant Human RARG Protein

Recombinant Human RARG Protein is a 50 kDa protein composed of 458 amino acids. It contains several functional domains, including a DNA-binding domain, a ligand-binding domain, and a transcriptional activation domain. The DNA-binding domain allows RARG to bind to specific DNA sequences, while the ligand-binding domain is responsible for binding to its ligand, retinoic acid. The transcriptional activation domain is necessary for the activation of target genes.

Activity of Recombinant Human RARG Protein

The main function of Recombinant Human RARG Protein is to act as a transcription factor, regulating the expression of various genes involved in cellular differentiation, proliferation, and apoptosis. It does so by binding to specific DNA sequences, known as retinoic acid response elements (RAREs), in the promoter regions of target genes. Upon binding to retinoic acid, RARG undergoes a conformational change, leading to the recruitment of co-regulatory proteins and the activation of target genes.

RARG is also involved in the regulation of embryonic development, particularly in the formation of the central nervous system, limbs, and heart. It is essential for the differentiation of various cell types, including neurons, muscle cells, and immune cells. Moreover, RARG has been shown to play a role in the maintenance of stem cell pluripotency and self-renewal.

Applications of Recombinant Human RARG Protein

Recombinant Human RARG Protein has various applications in the fields of research, medicine, and biotechnology. One of its main uses is in the study of retinoic acid signaling and its role in gene regulation. RARG is also used as a tool for studying the mechanisms of cellular differentiation and development.

In medicine, RARG has been linked to several diseases, including cancer, cardiovascular diseases, and neurodegenerative disorders. As such, Recombinant Human RARG Protein is a potential therapeutic target for these diseases. Additionally, RARG is also used in drug discovery and development, as it plays a crucial role in the metabolism and pharmacokinetics of retinoic acid and its derivatives.

In biotechnology, Recombinant Human RARG Protein is used in the production of monoclonal antibodies and vaccines. It is also used in the development of transgenic animals and plants, as RARG is involved in the regulation of gene expression in these organisms.

Conclusion

In summary, Recombinant Human RARG Protein is a multifunctional protein that plays a crucial role in the regulation of gene expression and cellular differentiation. Its structure, activity, and applications make it a valuable tool in various fields of science and medicine. Further research on RARG and its interactions with other proteins and ligands may provide insights into its role in health and disease, leading to the development of novel therapies and treatments.

Recombinant Human RARG Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RARG Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products