Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB6A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20340
Molecular weight:
21.16 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Arg12–Gly176
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB6A Protein, N-His

Product name ARO-P11795-100
Uniprot ID P20340
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG
Molecular weight 21.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg12-Gly176
Aliases /Synonyms Ras-related protein Rab-6A; Rab-6; RAB6A; RAB6
Reference ARO-P11795
Note For research use only.
Molecular Constructor
Arg12–Gly176
Product name ARO-P11795-1MG
Uniprot ID P20340
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG
Molecular weight 21.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg12-Gly176
Aliases /Synonyms Ras-related protein Rab-6A; Rab-6; RAB6A; RAB6
Reference ARO-P11795
Note For research use only.
Molecular Constructor
Arg12–Gly176
Product name ARO-P11795-50
Uniprot ID P20340
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG
Molecular weight 21.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg12-Gly176
Aliases /Synonyms Ras-related protein Rab-6A; Rab-6; RAB6A; RAB6
Reference ARO-P11795
Note For research use only.
Molecular Constructor
Arg12–Gly176

Introduction

Recombinant Human RAB6A Protein is a highly versatile protein that plays a crucial role in the regulation of intracellular vesicle trafficking. It is a member of the RAB family of small GTPases, which are key regulators of vesicle transport in eukaryotic cells. This protein has been extensively studied and its structure, activity, and applications have been well characterized. In this article, we will provide a detailed description of Recombinant Human RAB6A Protein, including its structure, activity, and applications.

Structure of Recombinant Human RAB6A Protein

Recombinant Human RAB6A Protein is a small GTPase that consists of 207 amino acids with a molecular weight of approximately 23 kDa. It contains a highly conserved GTP-binding domain, which is responsible for its GTPase activity. This domain is flanked by a C-terminal hypervariable region and an N-terminal helical domain. The N-terminal helical domain is involved in protein-protein interactions, while the C-terminal hypervariable region is responsible for targeting the protein to specific subcellular compartments.

Activity of Recombinant Human RAB6A Protein

Recombinant Human RAB6A Protein is primarily involved in the regulation of intracellular vesicle trafficking. It functions as a molecular switch, cycling between an active GTP-bound form and an inactive GDP-bound form. In its active form, RAB6A interacts with various effector proteins, which regulate different aspects of vesicle transport, such as vesicle budding, fusion, and movement along microtubules. These interactions are crucial for the proper targeting and delivery of vesicles to their respective destinations within the cell.

Apart from its role in vesicle trafficking, Recombinant Human RAB6A Protein has also been implicated in other cellular processes, such as cell division, cytokinesis, and autophagy. It has been shown to interact with proteins involved in these processes and regulate their activity. Additionally, RAB6A has been linked to the regulation of protein secretion and the maintenance of Golgi structure and function.

Applications of Recombinant Human RAB6A Protein

Recombinant Human RAB6A Protein has a wide range of applications in both basic research and biotechnology. In basic research, it is used as a tool to study the mechanisms of vesicle trafficking and other cellular processes in various cell types. Its ability to interact with different effector proteins makes it a valuable tool for dissecting the complex pathways involved in these processes.

In biotechnology, Recombinant Human RAB6A Protein is used in the production of recombinant proteins. It has been shown to enhance the secretion of certain proteins, making it a valuable tool for improving protein production in mammalian cell expression systems. Additionally, RAB6A has been used in the development of novel drug delivery systems. Its ability to regulate vesicle trafficking and target specific subcellular compartments makes it an attractive candidate for targeted drug delivery.

Conclusion

In conclusion, Recombinant Human RAB6A Protein is a highly versatile protein that plays a crucial role in the regulation of intracellular vesicle trafficking. Its structure, activity, and applications have been extensively studied and characterized. This protein has a wide range of applications in both basic research and biotechnology, making it a valuable tool for studying cellular processes and improving protein production and drug delivery. Further research on Recombinant Human RAB6A Protein is needed to fully understand its role in cellular processes and to explore its potential in other biotechnological applications.

Recombinant Human RAB6A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB6A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products