Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB39B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96DA2
Molecular weight:
24.39 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Gly192
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB39B Protein, N-His

Product name ARO-P12271-100
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192
Product name ARO-P12271-1MG
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192
Product name ARO-P12271-50
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192

Introduction to Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is a member of the RAB family of small GTPases and plays a crucial role in intracellular vesicle trafficking and membrane trafficking processes. In this article, we will explore the structure, activity, and applications of Recombinant Human RAB39B Protein.

Structure of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein is a 23 kDa protein that consists of 202 amino acids. It is composed of a conserved GTP-binding domain, a flexible switch I region, and a C-terminal hypervariable region. The GTP-binding domain is responsible for binding to guanine nucleotides and regulating the activity of the protein. The switch I region is involved in the conformational changes that occur upon GTP binding, while the C-terminal hypervariable region interacts with downstream effector molecules.

Activity of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein is a key regulator of vesicle trafficking and membrane trafficking processes. It is primarily involved in the transport of proteins and lipids between different cellular compartments. This protein acts as a molecular switch, cycling between an active GTP-bound form and an inactive GDP-bound form. The GTP-bound form interacts with downstream effector proteins, while the GDP-bound form is inactive.

The activity of Recombinant Human RAB39B Protein is also regulated by a variety of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). GEFs promote the exchange of GDP for GTP, leading to the activation of the protein, while GAPs stimulate the intrinsic GTPase activity, resulting in the inactivation of the protein.

Applications of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein has a wide range of applications in both basic research and drug discovery. It is commonly used as an antigen in immunological studies to generate specific antibodies against RAB39B. These antibodies can then be used for protein detection and localization studies in various cell types and tissues.

In addition, Recombinant Human RAB39B Protein has been implicated in several human diseases, including neurodegenerative disorders such as Parkinson’s disease and Alzheimer’s disease. Studies have shown that mutations in the RAB39B gene can lead to impaired vesicle trafficking and contribute to the pathogenesis of these diseases. Therefore, Recombinant Human RAB39B Protein is a valuable tool for studying the molecular mechanisms underlying these disorders.

Furthermore, Recombinant Human RAB39B Protein has potential therapeutic applications. It has been shown to interact with various proteins involved in cancer progression, making it a potential target for cancer therapy. Additionally, it has been reported to play a role in immune response regulation, suggesting its potential use in the treatment of autoimmune diseases.

Conclusion

In summary, Recombinant Human RAB39B Protein is a crucial player in intracellular vesicle trafficking and membrane trafficking processes. Its structure, activity, and applications make it a valuable tool for various research areas, including immunology, neurodegenerative diseases, and cancer. With its potential therapeutic applications, this protein holds promise for the development of novel treatments for various diseases.

Recombinant Human RAB39B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB39B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products