Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PRMT1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99873
Molecular weight:
38.25 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly61–Arg371
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PRMT1 Protein, N-His

Product name ARO-P10862-100
Uniprot ID Q99873
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly61-Arg371
Aliases /Synonyms IR1B4, Protein arginine N-methyltransferase 1, HRMT1L2, HMT2, Interferon receptor 1-bound protein 4, PRMT1, Histone-arginine N-methyltransferase PRMT1
Reference ARO-P10862
Note For research use only.
Molecular Constructor
Gly61–Arg371
Product name ARO-P10862-1MG
Uniprot ID Q99873
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly61-Arg371
Aliases /Synonyms IR1B4, Protein arginine N-methyltransferase 1, HRMT1L2, HMT2, Interferon receptor 1-bound protein 4, PRMT1, Histone-arginine N-methyltransferase PRMT1
Reference ARO-P10862
Note For research use only.
Molecular Constructor
Gly61–Arg371
Product name ARO-P10862-50
Uniprot ID Q99873
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly61-Arg371
Aliases /Synonyms IR1B4, Protein arginine N-methyltransferase 1, HRMT1L2, HMT2, Interferon receptor 1-bound protein 4, PRMT1, Histone-arginine N-methyltransferase PRMT1
Reference ARO-P10862
Note For research use only.
Molecular Constructor
Gly61–Arg371

Introduction to Recombinant Human PRMT1 Protein

Recombinant Human PRMT1 Protein, also known as Protein Arginine Methyltransferase 1, is a key enzyme involved in the process of protein methylation. This protein is produced through recombinant DNA technology, where the gene for PRMT1 is inserted into a host organism, typically bacteria, to produce large quantities of the protein for research and therapeutic purposes.

Structure of Recombinant Human PRMT1 Protein

The Recombinant Human PRMT1 Protein is a 353 amino acid protein with a molecular weight of approximately 40 kDa. It contains a catalytic domain responsible for its methyltransferase activity, as well as a SAM (S-adenosylmethionine) binding site and a zinc finger domain. The protein also has several conserved motifs, including the double E loop and the F/Y-rich loop, which are crucial for its enzymatic function.

Activity of Recombinant Human PRMT1 Protein

Recombinant Human PRMT1 Protein is a type I protein arginine methyltransferase, which means it catalyzes the transfer of a methyl group from SAM to arginine residues in target proteins. This methylation process plays a crucial role in regulating various cellular processes, including gene expression, protein-protein interactions, and signal transduction pathways.

PRMT1 specifically targets arginine residues located within glycine-arginine-rich (GAR) motifs, and catalyzes the formation of monomethylarginine (MMA) and asymmetric dimethylarginine (ADMA) on these residues. These modifications can have significant effects on the structure and function of target proteins, such as altering their stability, activity, and interactions with other molecules.

Applications of Recombinant Human PRMT1 Protein

Due to its crucial role in protein methylation, Recombinant Human PRMT1 Protein has a wide range of applications in both research and therapeutic fields.

Research Applications

Recombinant Human PRMT1 Protein is commonly used in research to study the effects of protein methylation on various cellular processes. It can be used to investigate the role of PRMT1 in specific pathways, as well as to identify and characterize its target proteins. Additionally, the protein can be used to study the effects of PRMT1 inhibitors and activators on cellular processes, providing valuable insights into potential therapeutic targets.

Therapeutic Applications

Due to its involvement in various cellular processes, Recombinant Human PRMT1 Protein has also shown potential as a therapeutic target for various diseases. For example, PRMT1 has been linked to cancer development and progression, making it a potential target for cancer treatment. Inhibitors of PRMT1 have also shown promise in treating neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease.

Furthermore, Recombinant Human PRMT1 Protein has been used in the development of diagnostic tools for diseases that involve PRMT1 dysregulation. For instance, ADMA, the product of PRMT1 activity, has been found to be elevated in patients with cardiovascular diseases, making it a potential biomarker for early diagnosis and monitoring of these conditions.

Conclusion

Recombinant Human PRMT1 Protein is a crucial enzyme involved in protein methylation, with a wide range of applications in research and therapeutics. Its structure, activity, and role in various cellular processes make it a valuable tool for understanding the complex mechanisms of protein regulation and identifying potential therapeutic targets. As research in this field continues to advance, Recombinant Human PRMT1 Protein will undoubtedly play a crucial role in furthering our understanding of protein methylation and its implications in health and disease.

Recombinant Human PRMT1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PRMT1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products