Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MICOS13 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5XKP0
Molecular weight:
22.56 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Asp27–Lys118
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MICOS13 Protein, N-His-SUMO

Product name ARO-P11270-100
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118
Product name ARO-P11270-1MG
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118
Product name ARO-P11270-50
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118

Introduction to Recombinant Human MICOS13 Protein

Recombinant Human MICOS13 Protein, also known as Mitochondrial Contact Site and Cristae Organizing System Subunit 13, is a protein that plays a crucial role in maintaining the structure and function of mitochondria. It is a highly conserved protein found in various species, including humans, and is encoded by the MICOS13 gene.

Structure of Recombinant Human MICOS13 Protein

The recombinant form of MICOS13 is a 16 kDa protein with a molecular weight of 144 amino acids. It consists of two transmembrane domains, a coiled-coil domain, and a C-terminal domain. The N-terminal domain is responsible for anchoring the protein to the inner mitochondrial membrane, while the C-terminal domain interacts with other MICOS subunits to form the mitochondrial contact site and cristae organizing system (MICOS) complex.

The MICOS complex is a multi-protein complex that is essential for maintaining the structure and function of mitochondria. It is responsible for organizing the inner mitochondrial membrane into cristae, which are necessary for efficient oxidative phosphorylation. The MICOS13 protein is a crucial component of this complex and is involved in stabilizing the structure of cristae and promoting the formation of contact sites between the inner and outer mitochondrial membranes.

Activity of Recombinant Human MICOS13 Protein

The primary function of MICOS13 is to maintain the structural integrity of mitochondria. It achieves this by forming contact sites between the inner and outer mitochondrial membranes, which allow for efficient communication and transport of molecules between these two compartments. The protein also plays a role in organizing the inner mitochondrial membrane into cristae, which are essential for the proper functioning of the electron transport chain and ATP production.

Studies have shown that MICOS13 is involved in regulating the size and shape of cristae, as well as their distribution within the mitochondrial matrix. It achieves this by interacting with other MICOS subunits and forming a scaffold-like structure that supports the cristae. Additionally, MICOS13 has been found to play a role in maintaining the balance of lipids in the inner mitochondrial membrane, which is crucial for maintaining membrane integrity and function.

Applications of Recombinant Human MICOS13 Protein

The unique structure and activity of MICOS13 make it an essential protein in various cellular processes, making it a promising target for research and potential therapeutic applications. Some of the potential applications of recombinant human MICOS13 protein are:

1. Study of Mitochondrial Dysfunction

Mitochondrial dysfunction has been linked to various diseases, including neurodegenerative disorders, metabolic disorders, and cancer. As MICOS13 plays a crucial role in maintaining mitochondrial structure and function, studying its activity and interactions can provide insights into the mechanisms of mitochondrial dysfunction and potential therapeutic targets.

2. Development of Therapies for Mitochondrial Diseases

Defects in the MICOS complex have been associated with various mitochondrial diseases, including Charcot-Marie-Tooth disease and Leigh syndrome. Recombinant human MICOS13 protein can be used to study these diseases and potentially develop therapeutic strategies to target the underlying molecular mechanisms.

3. Production of Antibodies

Recombinant human MICOS13 protein can be used as an antigen to produce antibodies that can be used for various applications, such as immunohistochemistry and western blotting. These antibodies can help in the detection and quantification of MICOS13 in different tissues and cell types, aiding in further research on its function and activity.

4. Potential Therapeutic Target for Cancer

Recent studies have shown that the MICOS complex plays a role in the regulation of cell proliferation and survival, making it a potential target for cancer therapy. As MICOS13 is a crucial component of this complex,

Recombinant Human MICOS13 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MICOS13 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products