Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PRKG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13237
Molecular weight:
40.58 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Ser431–Phe762
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PRKG2 Protein, N-His

Product name ARO-P12003-100
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762
Product name ARO-P12003-1MG
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762
Product name ARO-P12003-50
Uniprot ID Q13237
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Molecular weight 40.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser431-Phe762
Aliases /Synonyms cGK2, cGK 2, PRKG2, cGKII, PRKGR2, cGMP-dependent protein kinase II, cGMP-dependent protein kinase 2
Reference ARO-P12003
Note For research use only.
Molecular Constructor
Ser431–Phe762

Introduction to Recombinant Human PRKG2 Protein

Recombinant Human PRKG2 Protein, also known as cGMP-dependent protein kinase 2, is a member of the protein kinase family. This protein plays a crucial role in various cellular processes, including smooth muscle relaxation, platelet function, and neuronal signaling. The recombinant form of this protein is produced through genetic engineering techniques, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human PRKG2 Protein

The recombinant form of PRKG2 is a 75 kDa protein consisting of 671 amino acids. It contains a catalytic domain, a regulatory domain, and a leucine zipper motif. The catalytic domain is responsible for the phosphorylation of target proteins, while the regulatory domain acts as an autoinhibitory domain. The leucine zipper motif is involved in protein-protein interactions and plays a role in the dimerization of PRKG2.

Activity of Recombinant Human PRKG2 Protein

Recombinant Human PRKG2 Protein is a serine/threonine kinase that is activated by the second messenger cyclic guanosine monophosphate (cGMP). Upon activation, PRKG2 phosphorylates target proteins, leading to changes in their activity and function. This protein is involved in various signaling pathways, including the nitric oxide-cGMP pathway, which regulates smooth muscle relaxation, and the cGMP-PDE5 pathway, which regulates platelet function.

One of the key activities of PRKG2 is its role in smooth muscle relaxation. This protein is expressed in smooth muscle cells and is activated by cGMP, leading to the phosphorylation of target proteins involved in the relaxation of these cells. This activity is crucial in maintaining normal blood pressure and preventing conditions such as hypertension.

In addition to its role in smooth muscle relaxation, PRKG2 also plays a role in platelet function. Platelets are small blood cells involved in blood clotting. Upon activation, PRKG2 phosphorylates target proteins involved in platelet activation, leading to a decrease in platelet aggregation and clot formation. This activity is important in preventing conditions such as heart attacks and strokes.

Applications of Recombinant Human PRKG2 Protein

Recombinant Human PRKG2 Protein has various applications in both research and therapeutic settings. In research, this protein can be used to study the role of PRKG2 in different cellular processes, such as smooth muscle relaxation and platelet function. It can also be used to investigate the effects of mutations in the PRKG2 gene and their impact on protein function.

In therapeutic applications, recombinant PRKG2 can be used as a potential treatment for conditions such as hypertension and cardiovascular diseases. By targeting the cGMP-PDE5 pathway, recombinant PRKG2 can regulate platelet function and prevent blood clot formation. This protein can also be used to develop drugs that target the nitric oxide-cGMP pathway, which is involved in smooth muscle relaxation.

Conclusion

Recombinant Human PRKG2 Protein is a vital tool for understanding the role of PRKG2 in various cellular processes. Its structure, activity, and applications make it a valuable protein for both research and therapeutic purposes. By targeting the cGMP-PDE5 and nitric oxide-cGMP pathways, recombinant PRKG2 has the potential to treat conditions such as hypertension and cardiovascular diseases. Further research on this protein may lead to the development of new and effective treatments for these conditions.

Recombinant Human PRKG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PRKG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products