Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPP1CA, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62136
Molecular weight:
39.69 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
His Ser2–Lys330
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPP1CA, N-His

Product name ARO-P13584-100
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330
Product name ARO-P13584-1MG
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330
Product name ARO-P13584-50
Uniprot ID P62136
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Molecular weight 39.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Lys330
Aliases /Synonyms Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PPP1A, PPP1CA
Reference ARO-P13584
Note For research use only.
Molecular Constructor
His Ser2–Lys330

Introduction

Recombinant proteins have become essential tools in various fields of research and biotechnology. They are produced by inserting a gene encoding the desired protein into a host organism, allowing for large-scale production and purification. One such recombinant protein is Recombinant Human PPP1CA, which has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human PPP1CA

Recombinant Human PPP1CA, also known as protein phosphatase 1 catalytic subunit alpha, is a 37 kDa protein that belongs to the PPP family of serine/threonine phosphatases. It is encoded by the PPP1CA gene located on chromosome 11 in humans. The protein consists of 330 amino acids and contains a catalytic domain, a regulatory domain, and a C-terminal domain.

The catalytic domain of Recombinant Human PPP1CA is responsible for its phosphatase activity, which involves the dephosphorylation of serine and threonine residues on target proteins. The regulatory domain helps to regulate the activity of the catalytic domain, while the C-terminal domain is involved in protein-protein interactions.

Activity of Recombinant Human PPP1CA

As a serine/threonine phosphatase, Recombinant Human PPP1CA plays a crucial role in various cellular processes, including cell cycle regulation, signal transduction, and metabolism. It is involved in the dephosphorylation of key regulatory proteins, such as glycogen synthase, c-Myc, and tau, which are essential for proper cell function.

Studies have shown that Recombinant Human PPP1CA is highly specific for its substrates and exhibits optimal activity at a neutral pH. Its activity can be modulated by various factors, including metal ions, regulatory subunits, and post-translational modifications. Dysregulation of PPP1CA activity has been linked to various diseases, such as cancer, neurodegenerative disorders, and metabolic disorders.

Applications of Recombinant Human PPP1CA

Recombinant Human PPP1CA has been widely used as a research tool for studying the role of protein phosphatases in cellular processes. Its high specificity and activity make it a valuable tool for investigating the dephosphorylation of specific target proteins. It has also been used in drug discovery and development, as PPP1CA is a potential therapeutic target for various diseases.

One of the most promising applications of Recombinant Human PPP1CA is in the production of vaccines. It has been used as an antigen in vaccine development for diseases such as malaria, hepatitis B, and HIV. The protein’s ability to induce an immune response makes it a potential candidate for the development of novel vaccines.

Furthermore, Recombinant Human PPP1CA has also been used in the production of biosensors for the detection of various biomolecules. Its high specificity and activity make it a suitable candidate for the development of sensitive and accurate biosensors for diagnostic purposes.

Conclusion

In conclusion, Recombinant Human PPP1CA is a valuable recombinant protein that has been extensively studied for its structure, activity, and potential applications. Its role in cellular processes, potential therapeutic applications, and use as an antigen and biosensor make it a versatile tool for research and biotechnology. Further studies on this protein will continue to expand our understanding of its structure and function, leading to the development of new and innovative applications.

Recombinant Human PPP1CA, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PPP1CA, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products