Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PMFBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TBY8
Molecular weight:
19.86 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Asn150
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PMFBP1 Protein, N-His

Product name ARO-P11941-100
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150
Product name ARO-P11941-1MG
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150
Product name ARO-P11941-50
Uniprot ID Q8TBY8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKDEAGERDREVSSLNSKLLSLQLDIKNLHDVCKRQRKTLQDNQLCMEEAMNSSHDKKQAQALAFEESEVEFGSSKQCHLRQLQQLKKKLLVLQQELEFHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHN
Molecular weight 19.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn150
Aliases /Synonyms Polyamine-modulated factor 1-binding protein 1, PMFBP1, PMF-1-binding protein
Reference ARO-P11941
Note For research use only.
Molecular Constructor
Met1–Asn150

Introduction

Recombinant Human PMFBP1 Protein, also known as Platelet Mitochondrial Membrane Protein, is a recombinant protein that has been produced using genetic engineering techniques. This protein is an important antigen in the field of immunology and has various applications in both research and clinical settings. In this article, we will discuss the structure, activity, and applications of Recombinant Human PMFBP1 Protein.

Structure of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein is a single-chain polypeptide consisting of 362 amino acids with a molecular weight of approximately 40 kDa. It is composed of two functional domains – an N-terminal mitochondrial targeting sequence and a C-terminal platelet-specific domain. The N-terminal mitochondrial targeting sequence is responsible for the localization of the protein to the mitochondria, while the C-terminal domain is responsible for its platelet-specific function.

Activity of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein is primarily known for its role as an antigen in the immune response. It is expressed on the surface of platelets and is involved in the activation of platelets and the formation of blood clots. In addition, this protein has been found to play a role in the regulation of mitochondrial function and energy metabolism.

Studies have also shown that Recombinant Human PMFBP1 Protein has angiogenic activity, promoting the growth of new blood vessels. This activity is important in wound healing and tissue repair. Furthermore, this protein has been found to have anti-inflammatory properties, which may have potential therapeutic applications in various inflammatory diseases.

Applications of Recombinant Human PMFBP1 Protein

Recombinant Human PMFBP1 Protein has various applications in both research and clinical settings. In research, this protein is used as an antigen in studies related to platelet function and immune response. It is also used in studies related to mitochondrial function and energy metabolism.

In clinical settings, Recombinant Human PMFBP1 Protein has potential applications in the diagnosis and treatment of various diseases. Its role as an antigen makes it a potential biomarker for platelet-related disorders, such as thrombocytopenia and thrombosis. In addition, this protein’s angiogenic and anti-inflammatory properties make it a potential therapeutic target for wound healing and inflammatory diseases.

Furthermore, Recombinant Human PMFBP1 Protein has been used in the development of diagnostic tests for platelet function disorders. These tests can help in the early detection and diagnosis of platelet-related diseases, allowing for timely and effective treatment.

Conclusion

In conclusion, Recombinant Human PMFBP1 Protein is a single-chain polypeptide with a molecular weight of approximately 40 kDa. It is composed of two functional domains – an N-terminal mitochondrial targeting sequence and a C-terminal platelet-specific domain. This protein is primarily known for its role as an antigen in the immune response and has various applications in both research and clinical settings. Its potential as a biomarker and therapeutic target makes it a valuable protein in the field of immunology and platelet biology. Further research on this protein may uncover new insights into its structure and activity, leading to the development of novel diagnostic and therapeutic approaches.

Recombinant Human PMFBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PMFBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products