Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PAICS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P22234
Molecular weight:
49.24 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Met1–Leu425
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PAICS Protein, N-His

Product name ARO-P11993-100
Uniprot ID P22234
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 49.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu425
Aliases /Synonyms SAICAR synthetase, Multifunctional protein ADE2, ADE2, AIRC, PAICS, AIR carboxylase, PAIS
Reference ARO-P11993
Note For research use only.
Molecular Constructor
Met1–Leu425
Product name ARO-P11993-1MG
Uniprot ID P22234
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 49.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu425
Aliases /Synonyms SAICAR synthetase, Multifunctional protein ADE2, ADE2, AIRC, PAICS, AIR carboxylase, PAIS
Reference ARO-P11993
Note For research use only.
Molecular Constructor
Met1–Leu425
Product name ARO-P11993-50
Uniprot ID P22234
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Molecular weight 49.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu425
Aliases /Synonyms SAICAR synthetase, Multifunctional protein ADE2, ADE2, AIRC, PAICS, AIR carboxylase, PAIS
Reference ARO-P11993
Note For research use only.
Molecular Constructor
Met1–Leu425

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of a specific protein in a controlled and efficient manner. One such protein is the Recombinant Human PAICS Protein, which has gained significant attention in the scientific community due to its unique structure, diverse activity, and potential applications in various fields.

Structure of Recombinant Human PAICS Protein

The PAICS gene encodes for the phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS) enzyme, which is responsible for the conversion of phosphoribosylaminoimidazole carboxylase to phosphoribosylaminoimidazole succinocarboxamide in the purine biosynthesis pathway. The recombinant human PAICS protein is a fusion protein consisting of the N-terminal domain of PAICS and the C-terminal domain of the human dihydrofolate reductase (DHFR) enzyme. This fusion protein is expressed in E. coli and purified using affinity chromatography, resulting in a highly pure and active protein.

Activity of Recombinant Human PAICS Protein

The recombinant human PAICS protein has dual enzymatic activity, acting as both a phosphoribosylaminoimidazole carboxylase and a phosphoribosylaminoimidazole succinocarboxamide synthetase. This unique feature allows for the efficient conversion of phosphoribosylaminoimidazole carboxylase to phosphoribosylaminoimidazole succinocarboxamide, a crucial step in the purine biosynthesis pathway. This activity is essential for the production of purines, which are vital for DNA and RNA synthesis, as well as the regulation of cellular processes such as energy metabolism and signaling pathways.

Application of Recombinant Human PAICS Protein

The recombinant human PAICS protein has a wide range of potential applications in various fields, including research, diagnostics, and therapeutics.

Research

The recombinant human PAICS protein is a valuable tool for studying the purine biosynthesis pathway and its role in cellular processes. Its dual enzymatic activity and high purity make it ideal for biochemical and structural studies, as well as for drug discovery and development.

Diagnostics

PAICS is overexpressed in various types of cancer, making it a potential biomarker for cancer diagnosis and prognosis. The recombinant human PAICS protein can be used in diagnostic assays to detect the presence of PAICS in patient samples, providing valuable information for cancer detection and treatment.

Therapeutics

PAICS has been identified as a potential target for cancer therapy, and the recombinant human PAICS protein can be used in the development of novel drugs that specifically target this enzyme. Additionally, the dual enzymatic activity of the recombinant protein makes it a promising candidate for enzyme replacement therapy in individuals with PAICS deficiency, a rare metabolic disorder.

Conclusion

In summary, the recombinant human PAICS protein is a unique and versatile protein with a dual enzymatic activity and potential applications in research, diagnostics, and therapeutics. Its production through genetic engineering techniques allows for the production of large quantities of a pure and active protein, making it a valuable tool for studying the purine biosynthesis pathway and its role in various diseases. Further research and development of this protein hold great promise for advancements in the fields of biochemistry, medicine, and biotechnology.

Recombinant Human PAICS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PAICS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products