Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human P2RX5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q93086
Molecular weight:
32.22 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Lys53–Arg319
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human P2RX5 Protein, N-His

Product name ARO-P11593-100
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319
Product name ARO-P11593-1MG
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319
Product name ARO-P11593-50
Uniprot ID Q93086
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIR
Molecular weight 32.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Arg319
Aliases /Synonyms Purinergic receptor, P2X purinoceptor 5, P2RX5, P2X5, ATP receptor
Reference ARO-P11593
Note For research use only.
Molecular Constructor
Lys53–Arg319

Recombinant Human P2RX5 Protein: Structure, Activity and Application

Recombinant Human P2RX5 protein, also known as P2X purinoceptor 5, is a member of the P2X receptor family. This protein is encoded by the P2RX5 gene and is predominantly expressed in immune cells, specifically in T lymphocytes and natural killer cells. It plays a crucial role in the innate and adaptive immune response by responding to extracellular ATP and initiating downstream signaling pathways.

Structure of Recombinant Human P2RX5 Protein

The P2RX5 protein is composed of 397 amino acids and has a predicted molecular weight of approximately 44 kDa. It consists of two transmembrane domains, an extracellular loop, and intracellular N and C termini. The extracellular loop contains the ATP binding site and is responsible for ligand recognition and binding. The intracellular C-terminus is involved in protein-protein interactions and downstream signaling events.

Recombinant Human P2RX5 protein is produced through recombinant DNA technology, where the gene encoding for P2RX5 is inserted into a suitable expression vector and expressed in a host cell, typically E. coli or mammalian cells. The resulting protein is then purified to obtain a highly pure and active form of P2RX5.

Activity of Recombinant Human P2RX5 Protein

The main function of P2RX5 is to respond to extracellular ATP, which is released during cellular stress or damage. Upon binding to ATP, P2RX5 undergoes a conformational change, leading to the opening of a non-selective cation channel. This allows for the influx of calcium, sodium, and potassium ions, which triggers downstream signaling pathways and cellular responses.

Studies have shown that P2RX5 activation in T lymphocytes leads to the release of pro-inflammatory cytokines, such as interleukin-1 beta and tumor necrosis factor-alpha, and the upregulation of cell surface markers involved in T cell activation and differentiation. In natural killer cells, P2RX5 activation has been linked to cytotoxicity and the production of interferon-gamma, a key cytokine in the anti-viral and anti-tumor response.

Application of Recombinant Human P2RX5 Protein

Due to its role in the immune response, recombinant Human P2RX5 protein has potential applications in various fields, including immunology, oncology, and drug discovery. It can be used as an antigen in research studies to investigate the function of P2RX5 and its signaling pathways. Additionally, recombinant P2RX5 protein can be used to develop diagnostic assays for diseases associated with dysregulation of the immune system, such as autoimmune disorders and cancer.

In drug discovery, P2RX5 has been identified as a potential target for the development of immunomodulatory drugs. By modulating P2RX5 activity, it may be possible to regulate immune responses and potentially treat diseases characterized by excessive or insufficient immune activity. Recombinant Human P2RX5 protein can be used in high-throughput screening assays to identify compounds that modulate its activity, leading to the development of novel therapeutics.

Conclusion

In summary, recombinant Human P2RX5 protein is a key player in the immune response, responding to extracellular ATP and initiating downstream signaling pathways. Its structure, activity, and potential applications make it a valuable tool in research and drug discovery. Further studies on P2RX5 and its role in the immune system may lead to the development of novel therapies for various diseases.

Recombinant Human P2RX5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human P2RX5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products