Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NRAS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P01111
Molecular weight:
23.39 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Met1–Met189
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NRAS Protein, N-His

Product name ARO-P12390-100
Uniprot ID P01111
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Molecular weight 23.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Met189
Aliases /Synonyms GTPase NRas, NRAS, HRAS1, Transforming protein N-Ras
Reference ARO-P12390
Note For research use only.
Molecular Constructor
Met1–Met189
Product name ARO-P12390-1MG
Uniprot ID P01111
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Molecular weight 23.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Met189
Aliases /Synonyms GTPase NRas, NRAS, HRAS1, Transforming protein N-Ras
Reference ARO-P12390
Note For research use only.
Molecular Constructor
Met1–Met189
Product name ARO-P12390-50
Uniprot ID P01111
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Molecular weight 23.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Met189
Aliases /Synonyms GTPase NRas, NRAS, HRAS1, Transforming protein N-Ras
Reference ARO-P12390
Note For research use only.
Molecular Constructor
Met1–Met189

Introduction

Recombinant Human NRAS Protein, also known as Neuroblastoma RAS Viral Oncogene Homolog, is a protein that plays a crucial role in cell signaling and growth. It is a member of the RAS family of proteins and is encoded by the NRAS gene. This protein is widely used in scientific research and has potential applications in the development of targeted therapies for various diseases.

Structure of Recombinant Human NRAS Protein

Recombinant Human NRAS Protein is a small GTPase, with a molecular weight of approximately 21 kDa. It consists of 189 amino acids and has a conserved G domain, which is essential for its function. This protein also has a C-terminal CAAX motif, which is responsible for its membrane localization.

The three-dimensional structure of Recombinant Human NRAS Protein has been extensively studied using X-ray crystallography and NMR spectroscopy. It is composed of six alpha helices and six beta strands, which form a globular structure. The G domain contains a highly conserved switch I and switch II regions, which undergo conformational changes upon binding to GTP or GDP, thereby regulating the activity of the protein.

Activity of Recombinant Human NRAS Protein

Recombinant Human NRAS Protein acts as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, it interacts with downstream effector proteins, such as RAF, PI3K, and RALGDS, to initiate signaling pathways that regulate cell proliferation, survival, and differentiation. These pathways play a crucial role in normal cellular processes, but aberrant activation of NRAS signaling has been linked to various diseases, including cancer.

Mutations in the NRAS gene, which result in amino acid substitutions in the protein, are commonly found in human cancers, such as melanoma, acute myeloid leukemia, and thyroid cancer. These mutations lead to constitutive activation of NRAS signaling, promoting uncontrolled cell growth and proliferation. Therefore, understanding the activity of Recombinant Human NRAS Protein is essential for developing targeted therapies for these diseases.

Application of Recombinant Human NRAS Protein

Recombinant Human NRAS Protein has various applications in scientific research, including the study of cell signaling, cancer biology, and drug discovery. It is commonly used as an antigen in immunological assays, such as ELISA and Western blot, to detect the presence of NRAS in biological samples. It is also used in protein-protein interaction studies to identify its binding partners and understand the downstream signaling pathways it regulates.

Furthermore, Recombinant Human NRAS Protein is used in drug discovery efforts to develop targeted therapies for cancers with NRAS mutations. Inhibitors of NRAS signaling have shown promising results in preclinical studies, and ongoing clinical trials are evaluating their efficacy in patients with NRAS-mutant cancers.

Conclusion

Recombinant Human NRAS Protein is a crucial protein involved in cell signaling and growth. Its structure and activity have been extensively studied, and it has various applications in scientific research and potential therapeutic development. Further understanding of this protein’s role in disease and its interactions with other proteins may lead to the development of novel treatments for cancers and other diseases associated with aberrant NRAS signaling.

Keywords:

Recombinant protein, antigen, NRAS, GTPase, signaling, cancer, drug discovery, targeted therapy.

Recombinant Human NRAS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NRAS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products