Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NLRX1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86UT6
Molecular weight:
36.07 kDa

Original price was: €330.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Arg667–Ser975
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NLRX1 Protein, N-His

Product name ARO-P12406-100
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975
Product name ARO-P12406-1MG
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975
Product name ARO-P12406-50
Uniprot ID Q86UT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS
Molecular weight 36.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg667-Ser975
Aliases /Synonyms NLR family member X1, NOD5, Caterpiller protein 11.3, NOD9, Nucleotide-binding oligomerization domain protein 9, NLRX1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, NOD26, CLR11.3
Reference ARO-P12406
Note For research use only.
Molecular Constructor
Arg667–Ser975

Recombinant Human NLRX1 Protein: Structure, Activity, and Application

Introduction

Recombinant Human NLRX1 Protein, also known as NOD-like receptor X1, is a protein that plays a crucial role in the innate immune response. It belongs to the NLR family of proteins, which are involved in detecting and responding to pathogens and other foreign substances in the body. NLRX1 is a cytosolic protein that is expressed in various tissues, including the immune cells, and has been shown to have important functions in regulating inflammation, cell death, and metabolism.

Structure of Recombinant Human NLRX1 Protein

The structure of Recombinant Human NLRX1 Protein consists of several domains that are important for its function. It has a C-terminal leucine-rich repeat (LRR) domain, which is involved in recognizing and binding to specific antigens. This domain is followed by a central nucleotide-binding oligomerization domain (NOD), which is responsible for the activation of downstream signaling pathways. At the N-terminus, there is a mitochondrial targeting sequence that directs the protein to the mitochondria, where it plays a crucial role in regulating mitochondrial function.

Activity of Recombinant Human NLRX1 Protein

The main activity of Recombinant Human NLRX1 Protein is its ability to sense and respond to foreign substances, such as viral and bacterial components. Upon binding to these antigens, NLRX1 undergoes a conformational change, leading to the activation of downstream signaling pathways. This results in the production of pro-inflammatory cytokines and chemokines, which recruit immune cells to the site of infection and initiate an immune response. NLRX1 has also been shown to play a role in regulating mitochondrial function and cell death pathways, making it a crucial player in maintaining cellular homeostasis.

Application of Recombinant Human NLRX1 Protein

Recombinant Human NLRX1 Protein has a wide range of applications in both research and clinical settings. Its ability to recognize and respond to specific antigens makes it a valuable tool for studying the innate immune response and its role in various diseases. NLRX1 has been implicated in various inflammatory diseases, such as inflammatory bowel disease, rheumatoid arthritis, and sepsis, making it a potential therapeutic target. Additionally, studies have shown that NLRX1 plays a role in regulating metabolic pathways, making it a potential target for obesity and metabolic disorders.

Research Applications

  • Studying the role of NLRX1 in the innate immune response
  • Investigating the role of NLRX1 in inflammatory diseases
  • Examining the role of NLRX1 in metabolic disorders
  • Exploring the interaction between NLRX1 and other immune receptors

Clinical Applications

  • Potential therapeutic target for inflammatory diseases
  • Potential target for obesity and metabolic disorders
  • Development of diagnostic tools for diseases involving NLRX1 dysfunction

Conclusion

Recombinant Human NLRX1 Protein is an important protein involved in the innate immune response. Its structure, activity, and applications make it a valuable tool for studying and understanding various diseases. With ongoing research, further insights into the role of NLRX1 in health and disease will continue

Recombinant Human NLRX1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NLRX1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products