Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFKBIZ Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BYH8
Molecular weight:
16.89 kDa

Original price was: €308.00.Current price is: €275.00.

100ug 11% OFF + 275 loyalty points
Gln454–Leu586
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFKBIZ Protein, N-His

Product name ARO-P11694-100
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586
Product name ARO-P11694-1MG
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586
Product name ARO-P11694-50
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586

Introduction

Recombinant proteins are artificially produced proteins that are derived from genetic material and expressed in host cells. These proteins have become an essential tool in various fields of research and have revolutionized the biotechnology industry. One such protein is Recombinant Human NFKBIZ Protein, which has gained significant attention due to its unique structure, activity, and potential applications.

Structure of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein is a member of the nuclear factor-kappa B (NF-κB) family of transcription factors. It is encoded by the NFKBIZ gene located on chromosome 3 in humans. The protein consists of 608 amino acids with a molecular weight of approximately 68 kDa. It contains an N-terminal Rel homology domain (RHD) and a C-terminal ankyrin repeat domain (ARD), which are essential for its transcriptional activity.

The RHD domain of Recombinant Human NFKBIZ Protein is responsible for DNA binding and dimerization with other NF-κB family members. It also contains two nuclear localization signals (NLS) that facilitate its translocation from the cytoplasm to the nucleus. The ARD domain, on the other hand, mediates protein-protein interactions and is involved in the recruitment of co-activators or co-repressors for transcriptional regulation.

Activity of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein is a potent regulator of immune and inflammatory responses. It is activated by various stimuli, including pro-inflammatory cytokines, bacterial and viral infections, and cellular stress. Upon activation, it translocates to the nucleus and binds to specific DNA sequences, known as κB sites, to regulate the expression of target genes.

The transcriptional activity of Recombinant Human NFKBIZ Protein is dependent on its interaction with other proteins. It can form homodimers or heterodimers with other NF-κB family members, such as p65 and p50, to modulate gene expression. It can also interact with other transcription factors, such as AP-1 and STAT, to synergistically regulate gene expression.

Application of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein has been implicated in various biological processes, including immune response, inflammation, cell proliferation, and survival. Its dysregulation has been associated with several diseases, such as cancer, autoimmune disorders, and infectious diseases. Therefore, it has become a potential therapeutic target for the development of novel treatments.

One of the main applications of Recombinant Human NFKBIZ Protein is in the study of NF-κB signaling pathways. Its recombinant form allows for the manipulation of its expression and activity, providing insights into its role in different cellular processes. It has also been used to screen for potential inhibitors or activators of NF-κB signaling, which can aid in the development of new therapeutics.

Furthermore, Recombinant Human NFKBIZ Protein has been used in various in vitro and in vivo studies to elucidate its role in different diseases. For instance, its overexpression has been shown to promote cell proliferation and survival in cancer cells, while its inhibition has been linked to decreased inflammation in autoimmune disorders.

Conclusion

Recombinant Human NFKBIZ Protein is a crucial member of the NF-κB family of transcription factors, with a unique structure and diverse functions. Its recombinant form has allowed for a better understanding of its role in different biological processes and diseases. Further research on this protein could lead to the development of new therapeutic strategies for various diseases.

Recombinant Human NFKBIZ Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NFKBIZ Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products