Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD339/JAG1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78504
Molecular weight:
26.62 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
His Gly33–Asp250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD339/JAG1, N-His

Product name ARO-P13553-100
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250
Product name ARO-P13553-1MG
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250
Product name ARO-P13553-50
Uniprot ID P78504
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGD
Molecular weight 26.62 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly33-Asp250
Aliases /Synonyms JAG1, Jagged1, CD339, JAGL1, Protein jagged-1, hJ1
Reference ARO-P13553
Note For research use only.
Molecular Constructor
His Gly33–Asp250

Introduction to Recombinant Human CD339/JAG1

Recombinant Human CD339/JAG1, also known as Jagged-1, is a protein that plays a crucial role in the Notch signaling pathway. It is a transmembrane protein that is involved in various cellular processes such as cell differentiation, proliferation, and apoptosis. This protein is encoded by the JAG1 gene and is a member of the Jagged family of proteins. In this article, we will explore the structure, activity, and application of Recombinant Human CD339/JAG1.

Structure of Recombinant Human CD339/JAG1

The JAG1 gene is located on chromosome 20 in humans and is composed of 26 exons. The full-length protein consists of 1218 amino acids and has a molecular weight of approximately 134 kDa. The protein has a large extracellular domain, a transmembrane domain, and a short intracellular domain. The extracellular domain contains multiple epidermal growth factor-like (EGF) repeats and a Delta/Serrate/Lag-2 (DSL) domain, which are important for ligand-receptor interactions. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is responsible for activating downstream signaling pathways.

Activity of Recombinant Human CD339/JAG1

Recombinant Human CD339/JAG1 is a ligand for the Notch family of receptors, which are transmembrane proteins involved in cell-cell communication. Upon binding to the Notch receptor, CD339/JAG1 induces a conformational change in the receptor, leading to the cleavage and release of the Notch intracellular domain (NICD). The NICD then translocates to the nucleus and activates the transcription of target genes, resulting in various cellular responses.

One of the main functions of CD339/JAG1 is to regulate cell fate determination and differentiation. It is involved in the development of various tissues and organs, including the heart, nervous system, and immune system. CD339/JAG1 is also essential for maintaining the balance between cell proliferation and apoptosis, as it can promote or inhibit cell growth depending on the cellular context.

Application of Recombinant Human CD339/JAG1

Recombinant Human CD339/JAG1 has numerous applications in both research and clinical settings. Due to its role in cell differentiation and proliferation, it has been widely studied in the field of developmental biology. It has also been implicated in various diseases, such as cancer and cardiovascular disorders, making it a potential therapeutic target.

In research, recombinant CD339/JAG1 protein is commonly used to study the Notch signaling pathway and its effects on cell behavior. It can be used to induce Notch signaling in cell culture experiments, allowing researchers to investigate the downstream effects of this pathway. Additionally, CD339/JAG1 knockout models have been developed to study the physiological functions of this protein in vivo.

In clinical settings, CD339/JAG1 has shown potential as a diagnostic and prognostic marker for certain diseases. For example, increased levels of CD339/JAG1 have been found in patients with breast cancer and are associated with a poor prognosis. Furthermore, studies have shown that targeting CD339/JAG1 with specific inhibitors can inhibit tumor growth and sensitize cancer cells to chemotherapy, making it a promising therapeutic strategy for cancer treatment.

Conclusion

In summary, Recombinant Human CD339/JAG1 is a crucial protein in the Notch signaling pathway, involved in various cellular processes such as cell differentiation, proliferation, and apoptosis. Its structure, activity, and applications have been extensively studied, and it shows great potential as a therapeutic target and diagnostic marker in various diseases. Further research on CD339/JAG1 may provide valuable insights into its role in normal development and disease, leading to the development of new treatments and diagnostic tools.

Recombinant Human CD339/JAG1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD339/JAG1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products