Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NAP1L1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55209
Molecular weight:
35.65 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Arg72–Glu356
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NAP1L1 Protein, N-His

Product name ARO-P11844-100
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356
Product name ARO-P11844-1MG
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356
Product name ARO-P11844-50
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356

Introduction to Recombinant Human NAP1L1 Protein

Recombinant Human NAP1L1 Protein, also known as nucleosome assembly protein 1-like 1, is a protein that plays a crucial role in the formation of nucleosomes, the basic structural unit of chromatin. This protein is encoded by the NAP1L1 gene and is highly conserved among different species, indicating its importance in cellular processes.

Structure of Recombinant Human NAP1L1 Protein

The human NAP1L1 protein is composed of 337 amino acids and has a molecular weight of approximately 38 kDa. It contains several functional domains, including a histone binding domain and a nucleosome assembly domain, which are essential for its activity.

The crystal structure of NAP1L1 has been determined, revealing its unique three-dimensional architecture. The protein is composed of two distinct domains connected by a flexible linker region. The N-terminal domain contains the histone binding site, while the C-terminal domain contains the nucleosome assembly site. This structure allows NAP1L1 to interact with both histones and DNA, facilitating the assembly of nucleosomes.

Activity of Recombinant Human NAP1L1 Protein

Recombinant Human NAP1L1 Protein plays a crucial role in the assembly of nucleosomes, which are the building blocks of chromatin. It has been shown to interact with both histones and DNA, facilitating the formation of stable nucleosome structures.

NAP1L1 binds to histones, specifically H2A-H2B dimers, through its histone binding domain. This interaction is essential for the recruitment of histones to the DNA, which is the first step in nucleosome formation. NAP1L1 also has a nucleosome assembly domain, which interacts with DNA and promotes the formation of nucleosome structures.

Furthermore, NAP1L1 has been shown to have a chaperone-like activity, assisting in the proper folding and assembly of histones onto DNA. This activity is crucial for maintaining the stability and integrity of nucleosomes, which are essential for gene regulation and other cellular processes.

Applications of Recombinant Human NAP1L1 Protein

The unique structure and activity of Recombinant Human NAP1L1 Protein make it a valuable tool for various scientific applications. Some of its potential applications include:

Studying Chromatin Structure and Function

NAP1L1 is a key player in nucleosome assembly, making it an important protein for studying chromatin structure and function. Recombinant Human NAP1L1 Protein can be used in in vitro experiments to investigate the role of nucleosomes in gene regulation, DNA replication, and other cellular processes.

Epigenetic Research

Epigenetic modifications, such as histone acetylation and methylation, play a crucial role in gene expression and are regulated by nucleosome assembly. Recombinant Human NAP1L1 Protein can be used to study the effects of these modifications on chromatin structure and function.

Drug Discovery and Development

Abnormalities in nucleosome assembly have been linked to various diseases, including cancer. Recombinant Human NAP1L1 Protein can be used in drug discovery and development to screen for compounds that can modulate its activity and potentially treat diseases associated with nucleosome dysfunction.

Production of Antibodies

NAP1L1 has been identified as an antigen in several autoimmune diseases, including systemic lupus erythematosus and rheumatoid arthritis. Recombinant Human NAP1L1 Protein can be used to produce antibodies for diagnostic and therapeutic purposes.

Gene Therapy

NAP1L1 has been shown to play a role in DNA repair and recombination

Recombinant Human NAP1L1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NAP1L1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products