Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYOG Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P15173
Molecular weight:
22.81 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Leu66–Gln155
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYOG Protein, N-His-SUMO

Product name ARO-P11980-100
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155
Product name ARO-P11980-1MG
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155
Product name ARO-P11980-50
Uniprot ID P15173
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGG
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu66-Gln155
Aliases /Synonyms Myf-4, Myogenin, bHLHc3, BHLHC3, MYOG, MYF4, Myogenic factor 4, Class C basic helix-loop-helix protein 3
Reference ARO-P11980
Note For research use only.
Molecular Constructor
Leu66–Gln155

The Structure of Recombinant Human MYOG Protein

Recombinant Human MYOG Protein is a genetically engineered protein that is produced in the laboratory using recombinant DNA technology. This protein is a member of the myogenic regulatory factors (MRF) family and plays a crucial role in the development and differentiation of skeletal muscle cells.

The structure of Recombinant Human MYOG Protein is similar to that of other members of the MRF family, with a basic helix-loop-helix (bHLH) domain at the N-terminus and a helix-loop-helix (HLH) domain at the C-terminus. These domains are responsible for the protein’s ability to bind to specific DNA sequences and regulate gene expression.

In addition to these functional domains, Recombinant Human MYOG Protein also contains a transcriptional activation domain, which allows it to activate the expression of muscle-specific genes. This domain is located between the bHLH and HLH domains and is essential for the protein’s role in muscle development.

The activity of Recombinant Human MYOG Protein is regulated by post-translational modifications, such as phosphorylation and acetylation. These modifications can alter the protein’s stability and ability to interact with other proteins, thereby affecting its function in muscle development.

The Role of Recombinant Human MYOG Protein in Muscle Development

Recombinant Human MYOG Protein is a key regulator of muscle development, as it is involved in the differentiation of myoblasts into mature muscle cells. Myoblasts are precursor cells that give rise to muscle fibers, and MYOG is responsible for activating the expression of genes that are essential for this process.

During muscle development, MYOG is expressed in response to various signaling pathways, such as the Wnt and Notch pathways. These pathways activate the expression of MYOG, which then binds to specific DNA sequences in the promoter regions of muscle-specific genes, leading to their expression.

In addition to its role in muscle development, MYOG also plays a crucial role in muscle regeneration after injury. In response to muscle damage, MYOG is upregulated and promotes the formation of new muscle fibers to repair the damaged tissue.

Applications of Recombinant Human MYOG Protein

Recombinant Human MYOG Protein has a wide range of applications in both research and therapeutic settings. In research, this protein is used to study the mechanisms of muscle development and regeneration, as well as the role of MYOG in various diseases and disorders.

Therapeutically, Recombinant Human MYOG Protein has the potential to be used in the treatment of muscle wasting diseases, such as muscular dystrophy, where MYOG expression is impaired. It can also be used to promote muscle regeneration in individuals with muscle injuries or diseases.

Furthermore, Recombinant Human MYOG Protein has been used in the production of monoclonal antibodies for diagnostic and therapeutic purposes. This is due to its ability to activate the expression of muscle-specific genes, making it an ideal antigen for the production of specific antibodies.

In conclusion

Recombinant Human MYOG Protein is a crucial protein involved in the development and regeneration of skeletal muscle. Its structure, activity, and applications make it a valuable tool for both research and therapeutic purposes. With ongoing advancements in recombinant DNA technology, this protein holds great potential for the treatment of muscle-related diseases and disorders.

Recombinant Human MYOG Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MYOG Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products