Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYDGF Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q969H8
Molecular weight:
17.72 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Thr36–Leu173
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYDGF Protein, N-His

Product name ARO-P11949-100
Uniprot ID Q969H8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Molecular weight 17.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr36-Leu173
Aliases /Synonyms MYDGF, C19orf10, Myeloid-derived growth factor
Reference ARO-P11949
Note For research use only.
Molecular Constructor
Thr36–Leu173
Product name ARO-P11949-1MG
Uniprot ID Q969H8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Molecular weight 17.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr36-Leu173
Aliases /Synonyms MYDGF, C19orf10, Myeloid-derived growth factor
Reference ARO-P11949
Note For research use only.
Molecular Constructor
Thr36–Leu173
Product name ARO-P11949-50
Uniprot ID Q969H8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Molecular weight 17.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr36-Leu173
Aliases /Synonyms MYDGF, C19orf10, Myeloid-derived growth factor
Reference ARO-P11949
Note For research use only.
Molecular Constructor
Thr36–Leu173

Introduction

Recombinant proteins play a crucial role in various fields of research, including medicine, biotechnology, and drug development. One such protein is the Recombinant Human MYDGF Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will explore the structure, activity, and application of this protein in detail.

Structure of Recombinant Human MYDGF Protein

The Recombinant Human MYDGF Protein is a 13.5 kDa protein consisting of 120 amino acids. It belongs to the family of platelet-derived growth factors and is primarily expressed in the bone marrow, adipose tissue, and heart. The protein has a conserved cysteine-knot structure, which is essential for its biological activity.

The crystal structure of Recombinant Human MYDGF Protein has been determined, revealing a compact and globular shape. The protein contains a central beta-sheet surrounded by three alpha-helices, forming a characteristic “knot” structure. This unique structure is crucial for the protein’s ability to bind to its receptors and initiate signaling pathways.

Activity of Recombinant Human MYDGF Protein

The primary function of Recombinant Human MYDGF Protein is to promote cell proliferation and survival. It does so by binding to its receptor, PDGFRα, and activating downstream signaling pathways, including the PI3K/Akt and MAPK/ERK pathways. These pathways play a crucial role in cell growth, differentiation, and survival, making Recombinant Human MYDGF Protein a potent growth factor.

In addition to its role in cell proliferation, Recombinant Human MYDGF Protein has been shown to have anti-inflammatory and angiogenic properties. It can modulate the immune response by regulating the production of pro-inflammatory cytokines and promoting the recruitment of immune cells to the site of injury or infection. Moreover, the protein can stimulate the growth of new blood vessels, which is essential for tissue repair and wound healing.

Application of Recombinant Human MYDGF Protein

The unique structure and diverse functions of Recombinant Human MYDGF Protein make it a valuable tool in various research fields. One of its primary applications is in tissue regeneration and repair. The protein has been shown to enhance the proliferation and survival of various cell types, including stem cells, fibroblasts, and endothelial cells, making it a promising candidate for tissue engineering and regenerative medicine.

Moreover, Recombinant Human MYDGF Protein has shown potential in the treatment of various diseases, including cardiovascular disorders, diabetes, and inflammatory conditions. Its ability to promote angiogenesis and modulate the immune response makes it a potential therapeutic agent for these diseases.

Another application of Recombinant Human MYDGF Protein is in drug development. The protein’s role in cell growth and survival makes it an attractive target for drug discovery. Researchers are exploring the use of MYDGF inhibitors as potential anticancer agents, as well as the development of MYDGF-based drugs for the treatment of other diseases.

Conclusion

In conclusion, Recombinant Human MYDGF Protein is a unique and versatile protein with a conserved cysteine-knot structure. Its ability to promote cell proliferation, regulate the immune response, and stimulate angiogenesis makes it a valuable tool in various research fields and a potential therapeutic agent for the treatment of diseases. Further studies on this protein could lead to the development of new and innovative treatments for various disorders.

Recombinant Human MYDGF Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MYDGF Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products