Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MIXL1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H2W2
Molecular weight:
34.59 kDa

Original price was: €338.00.Current price is: €275.00.

100ug 19% OFF + 275 loyalty points
Ser94–Gly146
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MIXL1 Protein, N-GST & C-His

Product name ARO-P11354-100
Uniprot ID Q9H2W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSG
Molecular weight 34.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser94-Gly146
Aliases /Synonyms MIXL, MIXL1, Homeobox protein MIXL1, hMix, Mix.1 homeobox-like protein, MIX1 homeobox-like protein 1, Homeodomain protein MIX
Reference ARO-P11354
Note For research use only.
Molecular Constructor
Ser94–Gly146
Product name ARO-P11354-1MG
Uniprot ID Q9H2W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSG
Molecular weight 34.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser94-Gly146
Aliases /Synonyms MIXL, MIXL1, Homeobox protein MIXL1, hMix, Mix.1 homeobox-like protein, MIX1 homeobox-like protein 1, Homeodomain protein MIX
Reference ARO-P11354
Note For research use only.
Molecular Constructor
Ser94–Gly146
Product name ARO-P11354-50
Uniprot ID Q9H2W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSG
Molecular weight 34.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser94-Gly146
Aliases /Synonyms MIXL, MIXL1, Homeobox protein MIXL1, hMix, Mix.1 homeobox-like protein, MIX1 homeobox-like protein 1, Homeodomain protein MIX
Reference ARO-P11354
Note For research use only.
Molecular Constructor
Ser94–Gly146

Introduction

Recombinant Human MIXL1 Protein is a highly purified and biologically active protein that is produced through the process of recombinant DNA technology. This protein is a member of the Mix/Bix family of transcription factors and is involved in the regulation of early embryonic development and cell differentiation. In this article, we will explore the structure, activity, and applications of Recombinant Human MIXL1 Protein.

Structure of Recombinant Human MIXL1 Protein

Recombinant Human MIXL1 Protein is a 17 kDa protein that is composed of 147 amino acids. It contains a homeobox domain, which is a conserved DNA-binding domain that is found in many transcription factors. This domain is responsible for the binding of Recombinant Human MIXL1 Protein to specific DNA sequences, allowing it to regulate the expression of target genes. In addition, this protein also contains a C-terminal transactivation domain, which is important for its transcriptional activity.

Activity of Recombinant Human MIXL1 Protein

Recombinant Human MIXL1 Protein is a transcription factor that plays a crucial role in the early stages of embryonic development. It is involved in the formation of the mesoderm, which is one of the three primary germ layers that give rise to different tissues and organs in the developing embryo. This protein is also important for the differentiation of mesodermal cells into various cell types, such as muscle, bone, and blood cells.

Recombinant Human MIXL1 Protein exerts its activity by binding to specific DNA sequences in the regulatory regions of target genes. This binding leads to the activation or repression of gene expression, depending on the context. Through its transcriptional activity, this protein is able to control the expression of a wide range of genes that are involved in cell fate determination and differentiation.

Applications of Recombinant Human MIXL1 Protein

Recombinant Human MIXL1 Protein has a wide range of applications in both basic research and biotechnology. In basic research, this protein is used to study the mechanisms of early embryonic development and cell differentiation. Its ability to regulate gene expression makes it a valuable tool for investigating the roles of different genes in these processes.

In biotechnology, Recombinant Human MIXL1 Protein has potential applications in regenerative medicine. Its role in the differentiation of mesodermal cells makes it a promising candidate for promoting tissue repair and regeneration. In addition, this protein has also been studied for its potential in cancer therapy, as it has been shown to inhibit the growth of certain types of cancer cells.

Conclusion

Recombinant Human MIXL1 Protein is a biologically active protein that plays a crucial role in early embryonic development and cell differentiation. Its structure, which includes a homeobox domain and a transactivation domain, allows it to bind to specific DNA sequences and regulate the expression of target genes. This protein has a wide range of applications in basic research and biotechnology, making it a valuable tool for studying embryonic development and potentially contributing to the development of new therapies for various diseases.

Recombinant Human MIXL1 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human MIXL1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products