Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human MED7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O43513
Molecular weight:
29.28 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Met1–Pro233
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human MED7 Protein, N-His

Recombinant Human MED7 Protein, N-His

Product name ARO-P10128-100
Uniprot ID O43513
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Molecular weight 29.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro233
Aliases /Synonyms Mediator of RNA polymerase II transcription subunit 7, hMED7, Activator-recruited cofactor 34 kDa component, ARC34, Cofactor required for Sp1 transcriptional activation subunit 9, CRSP complex subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33, MED7, ARC34, CRSP9
Reference ARO-P10128
Note For research use only.
Molecular Constructor
Met1–Pro233
Product name ARO-P10128-1MG
Uniprot ID O43513
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Molecular weight 29.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro233
Aliases /Synonyms Mediator of RNA polymerase II transcription subunit 7, hMED7, Activator-recruited cofactor 34 kDa component, ARC34, Cofactor required for Sp1 transcriptional activation subunit 9, CRSP complex subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33, MED7, ARC34, CRSP9
Reference ARO-P10128
Note For research use only.
Molecular Constructor
Met1–Pro233
Product name ARO-P10128-50
Uniprot ID O43513
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Molecular weight 29.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro233
Aliases /Synonyms Mediator of RNA polymerase II transcription subunit 7, hMED7, Activator-recruited cofactor 34 kDa component, ARC34, Cofactor required for Sp1 transcriptional activation subunit 9, CRSP complex subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33, MED7, ARC34, CRSP9
Reference ARO-P10128
Note For research use only.
Molecular Constructor
Met1–Pro233

There are no reviews yet.

Be the first to review “Recombinant Human MED7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products