Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MDK/Midkine Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21741
Molecular weight:
20.95 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Asp51–Thr127
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MDK/Midkine Protein, N-His-SUMO

Product name ARO-P10791-100
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127
Product name ARO-P10791-1MG
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127
Product name ARO-P10791-50
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127

Structure of Recombinant Human MDK/Midkine Protein

Recombinant Human MDK/Midkine Protein, also known as MDK, is a small heparin-binding growth factor that is encoded by the MDK gene. It belongs to the pleiotropic cytokine family and is composed of 121 amino acids with a molecular weight of approximately 13 kDa. The protein is highly conserved among species, with 90% homology between human and mouse MDK.

MDK is a homodimer, meaning it is made up of two identical subunits held together by disulfide bonds. Each subunit contains three distinct domains: an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain is responsible for the heparin-binding activity of MDK, while the central domain is involved in receptor binding. The C-terminal domain is thought to play a role in the protein’s stability and secretion.

Activity of Recombinant Human MDK/Midkine Protein

MDK is a multifunctional protein that has been shown to have a wide range of biological activities. It acts as a growth factor, promoting cell proliferation and survival, and also has anti-apoptotic properties. MDK is involved in various physiological and pathological processes, such as embryonic development, wound healing, and tumorigenesis.

One of the key activities of MDK is its ability to bind to and activate several cell surface receptors, including the receptor tyrosine kinase anaplastic lymphoma kinase (ALK) and the low-density lipoprotein receptor-related protein (LRP). This activates various signaling pathways, such as the MAPK and PI3K/Akt pathways, leading to the stimulation of cell growth and survival.

In addition to its role as a growth factor, MDK also has anti-inflammatory properties. It has been shown to inhibit the production of pro-inflammatory cytokines and chemokines, and to promote the production of anti-inflammatory cytokines. This makes it a potential therapeutic target for inflammatory diseases.

Application of Recombinant Human MDK/Midkine Protein

The wide range of activities exhibited by MDK makes it a promising candidate for various therapeutic applications. One of the main applications of recombinant human MDK protein is in tissue regeneration and wound healing. Studies have shown that MDK promotes tissue repair and regeneration by stimulating the proliferation and migration of various cell types, such as endothelial cells and fibroblasts.

MDK has also been studied as a potential treatment for various diseases, including cancer. It has been shown to promote tumor growth and metastasis in some types of cancer, such as lung and breast cancer. However, in other types of cancer, such as neuroblastoma and melanoma, MDK has been found to have anti-tumor effects. This suggests that MDK may have a dual role in cancer progression, and further research is needed to fully understand its potential as a therapeutic target for cancer.

In addition to its role in tissue regeneration and cancer, MDK has also been studied for its potential in treating neurological disorders. It has been shown to have neuroprotective effects in various models of neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. MDK has also been found to promote the growth and survival of neurons, making it a potential treatment for nerve injuries and diseases.

In conclusion, recombinant human MDK/Midkine protein is a multifunctional protein with a diverse range of activities. Its structure, activity, and potential applications make it a promising candidate for various therapeutic purposes, including tissue regeneration, cancer treatment, and neurological disorders. Further research is needed to fully understand the mechanisms of action of MDK and its potential as a therapeutic target.

Recombinant Human MDK/Midkine Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MDK/Midkine Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products