Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MCC Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P23508
Molecular weight:
36.53 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Leu224–Ser294
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MCC Protein, N-GST & C-His

Product name ARO-P11365-100
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294
Product name ARO-P11365-1MG
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294
Product name ARO-P11365-50
Uniprot ID P23508
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSS
Molecular weight 36.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu224-Ser294
Aliases /Synonyms MCC, Protein MCC, Colorectal mutant cancer protein
Reference ARO-P11365
Note For research use only.
Molecular Constructor
Leu224–Ser294

Introduction

Recombinant Human MCC Protein, also known as Mutated in Colorectal Cancer protein, is a key player in the regulation of cell growth and differentiation. It is a highly conserved protein found in all vertebrates and is involved in various cellular processes such as cell cycle control, DNA repair, and apoptosis. In this article, we will delve into the structure, activity, and applications of this important protein.

Structure of Recombinant Human MCC Protein

The human MCC gene is located on chromosome 5 and encodes for a protein of 1,546 amino acids. The protein is composed of several domains, including a N-terminal domain, a central coiled-coil domain, and a C-terminal domain. The N-terminal domain is responsible for binding to other proteins, while the coiled-coil domain is involved in protein-protein interactions. The C-terminal domain contains a conserved motif known as the BRCT domain, which is important for DNA binding and repair.

Recombinant Human MCC Protein is produced through genetic engineering techniques, where the gene encoding for the protein is inserted into a host cell, such as bacteria or yeast. The protein is then expressed and purified to obtain a highly pure and active form.

Activity of Recombinant Human MCC Protein

The main function of MCC protein is to act as a tumor suppressor. It does so by inhibiting the activity of the oncogene, Myc, which is involved in cell proliferation and survival. MCC protein also plays a role in the regulation of the Wnt signaling pathway, which is important for embryonic development and tissue homeostasis. It acts as a negative regulator of this pathway, preventing excessive cell growth and promoting cell differentiation.

In addition to its role in tumor suppression, MCC protein is also involved in DNA repair. It has been shown to interact with proteins involved in DNA damage response, such as BRCA1 and RAD51, and is thought to play a role in the repair of double-stranded DNA breaks.

Applications of Recombinant Human MCC Protein

Recombinant Human MCC Protein has many potential applications in both research and clinical settings. Its role as a tumor suppressor makes it a promising target for cancer therapy. Studies have shown that MCC protein is downregulated in various types of cancer, including colorectal, breast, and lung cancer. Therefore, using recombinant MCC protein as a therapeutic agent could potentially inhibit tumor growth and promote cell differentiation.

In addition, recombinant MCC protein can be used as a research tool to study the mechanisms of cell growth and differentiation. Its ability to interact with various proteins involved in these processes makes it a valuable tool for understanding their function and regulation.

Furthermore, recombinant MCC protein can be used in diagnostic tests for cancer. Its downregulation in cancer cells could serve as a biomarker for early detection of certain types of cancer. In addition, measuring the levels of MCC protein in patient samples could provide valuable information about the progression of the disease and response to treatment.

Conclusion

In summary, Recombinant Human MCC Protein is a crucial protein involved in the regulation of cell growth and differentiation. Its structure, activity, and potential applications make it a promising target for cancer therapy and a valuable tool for research and diagnostics. With further studies and advancements in genetic engineering techniques, this protein holds great potential for improving human health and understanding the complex processes of cell growth and differentiation.

Recombinant Human MCC Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human MCC Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products