Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MATR3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P43243
Molecular weight:
23.83 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Lys478–Val576
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MATR3 Protein, N-His-SUMO

Product name ARO-P12119-100
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576
Product name ARO-P12119-1MG
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576
Product name ARO-P12119-50
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576

Introduction

Recombinant Human MATR3 Protein, also known as Matrin 3, is a highly conserved nuclear matrix protein that plays a crucial role in various cellular processes such as transcription, RNA processing, and DNA repair. This protein is encoded by the MATR3 gene and is expressed in various tissues including the brain, heart, and skeletal muscle. In this article, we will discuss the structure, activity, and applications of Recombinant Human MATR3 Protein.

Structure of Recombinant Human MATR3 Protein

Recombinant Human MATR3 Protein is a 125 kDa protein consisting of 1,128 amino acids. It has a highly conserved N-terminal domain containing two RNA recognition motifs (RRMs) and a C-terminal domain containing a zinc finger motif. The two RRMs are responsible for the binding of RNA, while the zinc finger motif is involved in protein-protein interactions. This unique structure allows MATR3 to interact with a variety of cellular components and perform its diverse functions.

Activity of Recombinant Human MATR3 Protein

Recombinant Human MATR3 Protein has multiple functions in the cell. It is primarily known for its role in RNA processing, where it binds to pre-mRNA and regulates alternative splicing. It also plays a crucial role in transcriptional regulation by interacting with transcription factors and chromatin-modifying enzymes. Additionally, MATR3 is involved in DNA repair, where it interacts with DNA damage response proteins and facilitates the repair of damaged DNA.

RNA processing

MATR3 has been shown to bind to pre-mRNA and regulate alternative splicing. This process is essential for the generation of different protein isoforms from a single gene. Dysregulation of alternative splicing has been linked to various diseases, making MATR3 a potential therapeutic target.

Transcriptional regulation

MATR3 interacts with transcription factors such as p53 and CREB to regulate gene expression. It also interacts with chromatin-modifying enzymes, such as histone deacetylases, to modulate chromatin structure and gene expression. These interactions suggest that MATR3 plays a crucial role in maintaining the balance of gene expression in the cell.

DNA repair

MATR3 has been shown to interact with DNA damage response proteins, such as BRCA1 and RAD51, and facilitate the repair of damaged DNA. This activity is essential for maintaining genome stability and preventing the development of diseases such as cancer.

Applications of Recombinant Human MATR3 Protein

Recombinant Human MATR3 Protein has various applications in both research and therapeutic settings.

Research applications

MATR3 is a highly studied protein, and its role in RNA processing, transcriptional regulation, and DNA repair has been extensively investigated. Recombinant Human MATR3 Protein can be used in in vitro and in vivo studies to understand its molecular mechanisms and its interactions with other cellular components. It can also be used to study the effects of MATR3 mutations on its structure and function.

Therapeutic applications

Due to its involvement in various cellular processes, MATR3 has been implicated in several diseases, including cancer and neurodegenerative disorders. Recombinant Human MATR3 Protein can be used as a potential therapeutic target for these diseases. It can also be used in drug discovery and development to screen for compounds that can modulate MATR3 activity.

Conclusion

Recombinant Human MATR3 Protein is a highly conserved nuclear matrix protein with diverse functions in the cell. Its unique structure allows it to interact with multiple cellular components and perform essential activities such as RNA processing, transcriptional regulation, and DNA repair. It has various applications in research and therapeutics, making it a valuable tool in understanding and potentially treating various diseases.

Recombinant Human MATR3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MATR3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products