Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MAD1L1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6D9
Molecular weight:
21.76 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
His544–Ala718
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MAD1L1 Protein, N-His

Product name ARO-P11958-100
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718
Product name ARO-P11958-1MG
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718
Product name ARO-P11958-50
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718

Introduction

Recombinant Human MAD1L1 Protein, also known as Mitotic Arrest Deficient 1 Like 1, is a highly conserved protein that plays a crucial role in cell cycle regulation. It is a key component of the spindle assembly checkpoint, which ensures proper chromosome alignment during cell division. This protein is encoded by the MAD1L1 gene and is expressed in various tissues and cell types.

Structure

The recombinant form of MAD1L1 Protein is produced through genetic engineering techniques, using recombinant DNA technology. It is a 718 amino acid protein with a molecular weight of approximately 80 kDa. The protein consists of multiple domains, including a MAD1 domain, a MAD2-binding domain, and a C-terminal coiled-coil domain. These domains are essential for the proper functioning of the protein in the cell cycle.

Activity

Recombinant Human MAD1L1 Protein plays a crucial role in the spindle assembly checkpoint, which is a surveillance mechanism that ensures proper chromosome alignment and prevents cells from progressing through mitosis if there are any errors or defects in the chromosomes. During the early stages of mitosis, MAD1L1 binds to the kinetochore, a protein complex that attaches to the chromosomes, and recruits other checkpoint proteins, such as MAD2 and BUBR1. This leads to the formation of the mitotic checkpoint complex (MCC), which inhibits the activity of the anaphase-promoting complex (APC/C), a protein complex responsible for initiating anaphase, the final stage of mitosis.

Application

Recombinant Human MAD1L1 Protein has various applications in both research and clinical settings. It is commonly used as an antigen in studies related to cell cycle regulation and mitosis. The recombinant protein can be used to generate specific antibodies for the detection and study of MAD1L1 in various tissues and cell types. It can also be used in biochemical assays to investigate the interaction between MAD1L1 and other checkpoint proteins, such as MAD2 and BUBR1.

In addition, recombinant MAD1L1 Protein has potential therapeutic applications in cancer treatment. As MAD1L1 is a key component of the spindle assembly checkpoint, its dysregulation has been linked to various types of cancer, including breast, lung, and colon cancer. Therefore, targeting MAD1L1 with recombinant protein or small molecule inhibitors could potentially disrupt the spindle assembly checkpoint and induce cell death in cancer cells.

Conclusion

In summary, Recombinant Human MAD1L1 Protein is a crucial component of the spindle assembly checkpoint, involved in maintaining the proper functioning of the cell cycle. Its recombinant form has various applications in research and has potential therapeutic implications in cancer treatment. With further studies and advancements in recombinant protein technology, the use of MAD1L1 in both basic and clinical research is expected to continue to expand.

Recombinant Human MAD1L1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MAD1L1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products