Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KRAS/K-Ras 2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P01116
Molecular weight:
22.22 kDa

Original price was: €245.00.Current price is: €223.00.

50ug 9% OFF + 223 loyalty points
Gly13–Cys185
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KRAS/K-Ras 2 Protein, N-His

Product name ARO-P10414-100
Uniprot ID P01116
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK
Molecular weight 22.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Cys185
Aliases /Synonyms c-Ki-ras, RASK2, GTPase KRas, K-Ras 2, c-K-ras, KRAS, Ki-Ras, KRAS2
Reference ARO-P10414
Note For research use only.
Molecular Constructor
Gly13–Cys185
Product name ARO-P10414-1MG
Uniprot ID P01116
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK
Molecular weight 22.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Cys185
Aliases /Synonyms c-Ki-ras, RASK2, GTPase KRas, K-Ras 2, c-K-ras, KRAS, Ki-Ras, KRAS2
Reference ARO-P10414
Note For research use only.
Molecular Constructor
Gly13–Cys185
Product name ARO-P10414-50
Uniprot ID P01116
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK
Molecular weight 22.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Cys185
Aliases /Synonyms c-Ki-ras, RASK2, GTPase KRas, K-Ras 2, c-K-ras, KRAS, Ki-Ras, KRAS2
Reference ARO-P10414
Note For research use only.
Molecular Constructor
Gly13–Cys185

Introduction to Recombinant Human KRAS/K-Ras 2 Protein

Recombinant Human KRAS/K-Ras 2 Protein, also known as KRAS2 or K-Ras, is a member of the Ras family of small GTPases that play a crucial role in cell signaling pathways. This protein is encoded by the KRAS gene and is involved in regulating cell growth, differentiation, and survival. Recombinant Human KRAS/K-Ras 2 Protein is a synthetic version of the native protein produced through genetic engineering techniques, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human KRAS/K-Ras 2 Protein

Recombinant Human KRAS/K-Ras 2 Protein is a 21 kDa protein consisting of 189 amino acids. It has a molecular weight of 21,000 Daltons and is composed of five distinct domains: the N-terminal domain, Switch I, Switch II, P-loop, and C-terminal domain. These domains are essential for the protein’s function and interaction with other molecules in the cell.

The N-terminal domain of Recombinant Human KRAS/K-Ras 2 Protein is responsible for membrane targeting, while the Switch I and Switch II regions are involved in GTP binding and hydrolysis. The P-loop, also known as the phosphate-binding loop, is responsible for coordinating the binding of nucleotides, and the C-terminal domain is involved in protein-protein interactions.

Activity of Recombinant Human KRAS/K-Ras 2 Protein

Recombinant Human KRAS/K-Ras 2 Protein is a GTPase, meaning it can bind and hydrolyze GTP molecules. This activity is crucial for the protein’s role in cell signaling pathways, as it allows it to switch between an active GTP-bound form and an inactive GDP-bound form. The active form of the protein can interact with downstream effectors, such as Raf, PI3K, and RalGDS, to initiate signaling cascades that regulate cell growth and survival.

Additionally, Recombinant Human KRAS/K-Ras 2 Protein is involved in the regulation of gene expression and cell proliferation. It can also interact with other proteins, such as GTPase-activating proteins (GAPs) and guanine nucleotide exchange factors (GEFs), to further modulate its activity and signaling pathways.

Application of Recombinant Human KRAS/K-Ras 2 Protein

Recombinant Human KRAS/K-Ras 2 Protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study cell signaling pathways and the role of KRAS in cancer development and progression. It can also be used to screen for potential inhibitors or activators of KRAS activity.

In the field of therapeutics, Recombinant Human KRAS/K-Ras 2 Protein is being investigated as a potential target for cancer treatment. Mutations in the KRAS gene are found in approximately 30% of all human cancers, making it an attractive target for drug development. Recombinant Human KRAS/K-Ras 2 Protein can be used to screen for potential inhibitors of KRAS activity, which could lead to the development of new cancer treatments.

Furthermore, Recombinant Human KRAS/K-Ras 2 Protein can also be used as an antigen in vaccine development. Vaccines targeting KRAS could potentially prevent or treat KRAS-driven cancers by stimulating the immune system to recognize and destroy cancer cells.

Conclusion

Recombinant Human KRAS/K-Ras 2 Protein is a crucial protein involved in cell signaling pathways and the regulation of cell growth and survival. Its synthetic form, produced through genetic engineering techniques, has various applications in research and therapeutics, making it a valuable tool in the study and treatment of cancer. With ongoing research and development

Recombinant Human KRAS/K-Ras 2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KRAS/K-Ras 2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products