Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ITLN1/Omentin, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WWA0
Molecular weight:
27.18 kDa

Original price was: €330.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Cys31–Gly253
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ITLN1/Omentin, N-His

Product name ARO-P13218-100
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253
Product name ARO-P13218-1MG
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253
Product name ARO-P13218-50
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253

Introduction

Recombinant Human ITLN1, also known as Omentin, is a protein that is produced through recombinant DNA technology. It is a member of the adipokine family and is primarily expressed in adipose tissue. Omentin has been found to play a role in various physiological processes, including glucose metabolism, inflammation, and cardiovascular health. In this article, we will delve into the structure, activity, and applications of Recombinant Human ITLN1/Omentin.

Structure of Recombinant Human ITLN1/Omentin

Recombinant Human ITLN1 is a glycoprotein with a molecular weight of approximately 34 kDa. It is composed of 313 amino acids and has a predicted secondary structure consisting of alpha-helices and beta-sheets. The protein contains two distinct domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker region. The N-terminal domain is responsible for the binding of Omentin to its receptor, while the C-terminal domain is involved in the regulation of its activity.

Activity of Recombinant Human ITLN1/Omentin

Omentin has been found to have various activities in the body, making it a promising therapeutic target for various diseases. One of its main functions is its role in glucose metabolism. Omentin has been shown to enhance insulin sensitivity and glucose uptake in adipocytes, leading to improved glucose homeostasis. This activity of Omentin is particularly important in the development of insulin resistance and type 2 diabetes.

In addition to its role in glucose metabolism, Omentin also has anti-inflammatory properties. It has been shown to reduce the production of pro-inflammatory cytokines and inhibit the activation of inflammatory pathways in various cell types. This anti-inflammatory activity makes Omentin a potential therapeutic agent for conditions such as inflammatory bowel disease and rheumatoid arthritis.

Moreover, Omentin has been found to have a protective effect on cardiovascular health. It has been shown to inhibit the proliferation of smooth muscle cells and prevent the formation of atherosclerotic plaques. Omentin also has vasodilatory properties, which can help improve blood flow and prevent hypertension.

Applications of Recombinant Human ITLN1/Omentin

The potential applications of Recombinant Human ITLN1/Omentin are vast, given its diverse range of activities. One of the most promising applications is in the treatment of type 2 diabetes. Omentin has been shown to improve insulin sensitivity and glucose uptake, making it a potential therapeutic option for managing this disease. Additionally, Omentin may also have a role in the prevention of cardiovascular complications associated with diabetes.

Furthermore, Omentin has potential applications in the treatment of inflammatory diseases. Its anti-inflammatory properties make it a potential therapeutic option for conditions such as inflammatory bowel disease, rheumatoid arthritis, and atherosclerosis. Omentin may also have a role in the treatment of obesity, as it has been found to regulate adipogenesis and fat accumulation.

In the field of diagnostics, Recombinant Human ITLN1/Omentin can be used as an antigen for the development of diagnostic tests for various diseases. Its expression in adipose tissue and its involvement in various physiological processes make it a potential biomarker for conditions such as obesity, diabetes, and cardiovascular disease.

Conclusion

Recombinant Human ITLN1/Omentin is a promising protein with diverse physiological activities. Its structure, activity, and potential applications make it a valuable target for therapeutic and diagnostic purposes. Further research on the protein and its mechanisms of action may lead to the development of novel treatments for various diseases.

Recombinant Human ITLN1/Omentin, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ITLN1/Omentin, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products