Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PIK3AP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6ZUJ8
Molecular weight:
30.03 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Leu489–Ser730
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PIK3AP1, N-His

Product name ARO-P13285-100
Uniprot ID Q6ZUJ8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTSSTASSTSNRS
Molecular weight 30.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu489-Ser730
Aliases /Synonyms BCAP, B-cell phosphoinositide 3-kinase adapter protein 1, PIK3AP1, B-cell adapter for phosphoinositide 3-kinase, Phosphoinositide 3-kinase adapter protein 1
Reference ARO-P13285
Note For research use only.
Molecular Constructor
Leu489–Ser730
Product name ARO-P13285-1MG
Uniprot ID Q6ZUJ8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTSSTASSTSNRS
Molecular weight 30.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu489-Ser730
Aliases /Synonyms BCAP, B-cell phosphoinositide 3-kinase adapter protein 1, PIK3AP1, B-cell adapter for phosphoinositide 3-kinase, Phosphoinositide 3-kinase adapter protein 1
Reference ARO-P13285
Note For research use only.
Molecular Constructor
Leu489–Ser730
Product name ARO-P13285-50
Uniprot ID Q6ZUJ8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTSSTASSTSNRS
Molecular weight 30.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu489-Ser730
Aliases /Synonyms BCAP, B-cell phosphoinositide 3-kinase adapter protein 1, PIK3AP1, B-cell adapter for phosphoinositide 3-kinase, Phosphoinositide 3-kinase adapter protein 1
Reference ARO-P13285
Note For research use only.
Molecular Constructor
Leu489–Ser730

Title: Introduction to Recombinant Human PIK3AP1

Recombinant Human PIK3AP1, also known as phosphoinositide-3-kinase adapter protein 1, is a protein that plays a crucial role in the regulation of cellular signaling pathways. It is a key component of the phosphoinositide 3-kinase (PI3K) signaling pathway, which is involved in various cellular processes such as cell growth, proliferation, and survival. In this article, we will delve deeper into the structure, activity, and application of Recombinant Human PIK3AP1.

Title: Structure of Recombinant Human PIK3AP1

Recombinant Human PIK3AP1 is a 72-kDa protein composed of 640 amino acids. It contains a pleckstrin homology (PH) domain, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The PH domain is responsible for binding to phosphatidylinositol 3,4,5-trisphosphate (PIP3) and is crucial for the recruitment of PI3K to the cell membrane. The proline-rich region interacts with various proteins, including the p85 regulatory subunit of PI3K, and is involved in the regulation of PI3K activity. The SH3 domain is responsible for binding to proline-rich motifs in other proteins, thus mediating protein-protein interactions.

Title: Activity of Recombinant Human PIK3AP1

Recombinant Human PIK3AP1 acts as an adaptor protein that links PI3K to upstream signaling molecules, such as growth factor receptors and G protein-coupled receptors. Upon activation of these receptors, PIK3AP1 is recruited to the cell membrane through its PH domain and interacts with the p85 subunit of PI3K, leading to the activation of PI3K. This results in the production of PIP3, which in turn activates downstream signaling pathways such as the Akt/mTOR pathway, leading to cellular proliferation and survival.

Title: Role of Recombinant Human PIK3AP1 in Cancer

The PI3K signaling pathway is frequently dysregulated in cancer, making it an attractive target for cancer therapy. Recombinant Human PIK3AP1 has been shown to play a crucial role in the development and progression of various types of cancer. It has been found to be overexpressed in several types of cancer, including breast, lung, and prostate cancer. Studies have also shown that targeting PIK3AP1 can inhibit tumor growth and sensitize cancer cells to chemotherapy.

Title: Applications of Recombinant Human PIK3AP1

Recombinant Human PIK3AP1 has various applications in both basic research and drug development. It can be used as a tool to study the PI3K signaling pathway and its role in various cellular processes. It can also be used to investigate the role of PIK3AP1 in cancer and other diseases. Recombinant Human PIK3AP1 can also be used as a potential target for the development of novel cancer therapies. In addition, it can be used as a diagnostic marker for certain types of cancer due to its overexpression in cancer cells.

Title: Production of Recombinant Human PIK3AP1

Recombinant Human PIK3AP1 can be produced using recombinant DNA technology. The gene encoding PIK3AP1 is cloned into an expression vector and transfected into host cells, such as E. coli or mammalian cells. The recombinant protein is then purified using various techniques, such as affinity chromatography and size exclusion chromatography. The purified protein can be used for various applications, including in vitro studies and drug development.

In conclusion, Recombinant Human PIK3AP1 is a key player in the PI3K signaling pathway and has important implications in cancer and other diseases. Its structure, activity, and applications make it a valuable tool for both basic research and drug development. Further studies on this protein may lead to a better understanding of its role in disease and the development of

Recombinant Human PIK3AP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PIK3AP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products