Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IRS2 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y4H2
Molecular weight:
25.36 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly185–Arg301
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IRS2 Protein, N-His-SUMO

Product name ARO-P11344-100
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301
Product name ARO-P11344-1MG
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301
Product name ARO-P11344-50
Uniprot ID Q9Y4H2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
Molecular weight 25.36 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Arg301
Aliases /Synonyms IRS2, Insulin receptor substrate 2, IRS-2
Reference ARO-P11344
Note For research use only.
Molecular Constructor
Gly185–Arg301

Introduction to Recombinant Human IRS2 Protein

Recombinant Human IRS2 Protein, also known as Insulin Receptor Substrate 2, is a protein that plays a crucial role in the insulin signaling pathway. It is a key mediator of insulin’s metabolic and mitogenic effects, making it an important target for research and therapeutic development. In this article, we will explore the structure, activity, and applications of Recombinant Human IRS2 Protein.

Structure of Recombinant Human IRS2 Protein

Recombinant Human IRS2 Protein is a 132 kDa protein composed of 1338 amino acids. It is encoded by the IRS2 gene located on chromosome 13 in humans. The protein consists of several domains, including a pleckstrin homology (PH) domain, a phosphotyrosine binding (PTB) domain, and multiple tyrosine phosphorylation sites. These domains allow for the interaction of IRS2 with various signaling molecules, such as insulin receptors and other tyrosine kinases.

Additionally, Recombinant Human IRS2 Protein has multiple serine/threonine phosphorylation sites, which regulate its activity and function. These phosphorylation sites can be targeted by various kinases, including Akt and mTOR, to modulate insulin signaling and cellular responses.

Activity of Recombinant Human IRS2 Protein

The primary function of Recombinant Human IRS2 Protein is to act as an adaptor protein in the insulin signaling pathway. Upon binding of insulin to its receptor, IRS2 is phosphorylated on tyrosine residues, resulting in the recruitment and activation of downstream signaling molecules, such as PI3K and Akt. This leads to the activation of various metabolic and mitogenic pathways, including glucose uptake, glycogen synthesis, and cell growth and proliferation.

In addition to its role in insulin signaling, Recombinant Human IRS2 Protein has also been shown to play a role in other cellular processes, such as cell survival, differentiation, and gene expression. It has been implicated in the development and progression of various diseases, including diabetes, cancer, and neurodegenerative disorders.

Applications of Recombinant Human IRS2 Protein

The use of Recombinant Human IRS2 Protein in research and therapeutic applications has been widely explored. One of the main applications of this protein is in the study of insulin signaling and its role in metabolic disorders, such as diabetes. Recombinant Human IRS2 Protein can be used to investigate the mechanisms of insulin resistance and to develop new treatments for diabetes.

Furthermore, Recombinant Human IRS2 Protein has been used in cancer research, as it has been shown to play a role in cell growth and proliferation. It has been implicated in various types of cancer, including breast, prostate, and pancreatic cancer. Studying the activity of this protein in cancer cells can provide valuable insights into the development and progression of these diseases.

In addition, Recombinant Human IRS2 Protein has potential therapeutic applications. It has been suggested as a potential target for drug development in the treatment of diabetes and cancer. By modulating the activity of this protein, it may be possible to improve insulin sensitivity and inhibit cancer cell growth.

Conclusion

In conclusion, Recombinant Human IRS2 Protein is a crucial mediator of insulin signaling, with a complex structure and multiple functions. Its role in various cellular processes and diseases makes it an important target for research and therapeutic development. As our understanding of this protein continues to grow, it may lead to new treatments for diabetes, cancer, and other diseases.

Recombinant Human IRS2 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IRS2 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products