Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ING2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H160
Molecular weight:
35.17 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Glu204–Glu263
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ING2 Protein, N-GST & C-His

Product name ARO-P12373-100
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263
Product name ARO-P12373-1MG
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263
Product name ARO-P12373-50
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263

Introduction to Recombinant Human ING2 Protein

Recombinant Human ING2 Protein is a highly sought-after protein in the field of molecular biology and biochemistry. This protein is a member of the Inhibitor of Growth (ING) family, which plays a crucial role in regulating cell growth, differentiation, and apoptosis. ING proteins have been extensively studied for their tumor suppressor activity, and Recombinant Human ING2 Protein is no exception. In this article, we will explore the structure, activity, and application of this important protein.

Structure of Recombinant Human ING2 Protein

Recombinant Human ING2 Protein is a 323 amino acid protein with a molecular weight of approximately 37 kDa. It contains a highly conserved N-terminal plant homeodomain (PHD) finger, a central nuclear localization signal (NLS), and a C-terminal leucine zipper-like domain. The PHD finger is responsible for binding to histone H3, while the NLS is required for nuclear localization of the protein. The leucine zipper-like domain is involved in protein-protein interactions, specifically with the transcriptional co-activator p300.

Activity of Recombinant Human ING2 Protein

Recombinant Human ING2 Protein is a multifunctional protein with diverse activities. It has been shown to be a transcriptional co-regulator, chromatin modifier, and tumor suppressor. As a transcriptional co-regulator, ING2 interacts with various transcription factors and co-activators to regulate gene expression. It can either activate or repress gene transcription depending on the context. ING2 also has histone acetyltransferase activity, which allows it to modify chromatin structure and regulate gene expression.

One of the most well-studied activities of Recombinant Human ING2 Protein is its tumor suppressor function. It has been shown to inhibit cell proliferation, induce apoptosis, and suppress tumor growth in various cancer types. ING2 achieves this by regulating the expression of key genes involved in cell cycle control, DNA repair, and apoptosis. It also interacts with other tumor suppressor proteins, such as p53, to enhance their activity.

Application of Recombinant Human ING2 Protein

Given its diverse activities, Recombinant Human ING2 Protein has numerous potential applications in the field of cancer research and therapy. Its tumor suppressor activity makes it a promising candidate for cancer treatment. Studies have shown that overexpression of ING2 can inhibit tumor growth and sensitize cancer cells to chemotherapy. Additionally, the PHD finger and NLS of ING2 have been targeted for drug development, as they are involved in interactions with key proteins involved in cancer progression.

Recombinant Human ING2 Protein also has potential applications in other diseases and conditions. It has been shown to play a role in regulating immune responses and inflammation, making it a potential target for autoimmune diseases. Its role in chromatin modification also suggests it may have a role in aging and age-related diseases.

Conclusion

In summary, Recombinant Human ING2 Protein is a multifunctional protein with diverse activities. Its structure, including the PHD finger, NLS, and leucine zipper-like domain, allows it to interact with various proteins and regulate gene expression. Its tumor suppressor activity and potential applications in cancer treatment make it a highly sought-after protein in the field of cancer research. Further studies on the structure and activity of Recombinant Human ING2 Protein may lead to new insights into its role in various diseases and potential therapeutic applications.

Recombinant Human ING2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ING2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products