Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SCN9A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15858
Molecular weight:
20.54 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Glu1761–Lys1918
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SCN9A Protein, N-His

Product name ARO-P11640-100
Uniprot ID Q15858
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIK
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1761-Lys1918
Aliases /Synonyms Sodium channel protein type 9 subunit alpha, NENA, Neuroendocrine sodium channel, Sodium channel protein type IX subunit alpha, SCN9A, Voltage-gated sodium channel subunit alpha Nav1.7, PN1, Peripheral sodium channel 1, hNE-Na
Reference ARO-P11640
Note For research use only.
Molecular Constructor
Glu1761–Lys1918
Product name ARO-P11640-1MG
Uniprot ID Q15858
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIK
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1761-Lys1918
Aliases /Synonyms Sodium channel protein type 9 subunit alpha, NENA, Neuroendocrine sodium channel, Sodium channel protein type IX subunit alpha, SCN9A, Voltage-gated sodium channel subunit alpha Nav1.7, PN1, Peripheral sodium channel 1, hNE-Na
Reference ARO-P11640
Note For research use only.
Molecular Constructor
Glu1761–Lys1918
Product name ARO-P11640-50
Uniprot ID Q15858
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIK
Molecular weight 20.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1761-Lys1918
Aliases /Synonyms Sodium channel protein type 9 subunit alpha, NENA, Neuroendocrine sodium channel, Sodium channel protein type IX subunit alpha, SCN9A, Voltage-gated sodium channel subunit alpha Nav1.7, PN1, Peripheral sodium channel 1, hNE-Na
Reference ARO-P11640
Note For research use only.
Molecular Constructor
Glu1761–Lys1918

SDS-PAGE for Recombinant Human SCN9A Protein, N-His

SDS-PAGE for Recombinant Human SCN9A Protein, N-His

Recombinant Human SCN9A Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human SCN9A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SCN9A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products