Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IFT43 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FT9
Molecular weight:
24.57 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Ile103–Thr208
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IFT43 Protein, N-His-SUMO

Product name ARO-P11149-100
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208
Product name ARO-P11149-1MG
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208
Product name ARO-P11149-50
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208

Introduction

Recombinant Human IFT43 Protein, also known as intraflagellar transport protein 43, is a protein that plays a crucial role in the formation and maintenance of cilia, which are hair-like structures found on the surface of many cells. This protein is produced through recombinant DNA technology, making it a valuable tool for studying cilia-related diseases and potential therapeutic applications.

Structure of Recombinant Human IFT43 Protein

Recombinant Human IFT43 Protein is a 43-kDa protein that is composed of 364 amino acids. It belongs to the intraflagellar transport (IFT) protein family, which is essential for the assembly and function of cilia. The protein contains several conserved domains, including an N-terminal WD40 repeat domain and a C-terminal coiled-coil domain. These domains are important for the protein’s interaction with other IFT proteins and its role in cilia formation.

Activity of Recombinant Human IFT43 Protein

The primary function of Recombinant Human IFT43 Protein is to facilitate the transport of proteins and other molecules along the ciliary axoneme, which is the structural core of cilia. This transport process is crucial for the assembly and maintenance of cilia, as well as for the proper functioning of cilia-related signaling pathways. IFT43 accomplishes this by forming a complex with other IFT proteins and motor proteins, which work together to move cargo along the ciliary axoneme.

Application of Recombinant Human IFT43 Protein

Recombinant Human IFT43 Protein has a wide range of applications in both research and therapeutic settings. Its role in cilia formation and function makes it a valuable tool for studying cilia-related diseases, such as ciliopathies, which are genetic disorders caused by defects in cilia. By studying the activity and interactions of IFT43, researchers can gain a better understanding of the underlying mechanisms of these diseases and potentially develop new treatments.

In addition, Recombinant Human IFT43 Protein has potential therapeutic applications in the treatment of cilia-related diseases. For example, studies have shown that mutations in IFT43 can lead to Bardet-Biedl syndrome, a ciliopathy that affects multiple organ systems. By producing recombinant IFT43 protein, researchers can potentially develop targeted therapies to correct the underlying genetic defect and improve the symptoms of this disease.

Furthermore, Recombinant Human IFT43 Protein has been used in the development of diagnostic tools for cilia-related diseases. For example, it has been used as an antigen in immunoassays to detect the presence of antibodies against IFT43 in patients with ciliopathies. These tests can aid in the diagnosis and monitoring of these diseases, allowing for earlier detection and treatment.

Conclusion

In summary, Recombinant Human IFT43 Protein is a crucial component of the intraflagellar transport machinery, playing a vital role in cilia formation and function. Through recombinant DNA technology, this protein can be produced in large quantities and used for various research and therapeutic purposes. Its structural characteristics, activity, and potential applications make it a valuable tool for studying cilia-related diseases and developing new treatments.

Recombinant Human IFT43 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IFT43 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products