Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HOXA10 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P31260
Molecular weight:
21.33 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Arg340–Ser410
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HOXA10 Protein, N-His-SUMO

Product name ARO-P11970-100
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410
Product name ARO-P11970-1MG
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410
Product name ARO-P11970-50
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410

Introduction to Recombinant Human HOXA10 Protein

Recombinant Human HOXA10 Protein, also known as Homeobox A10, is a protein that plays a crucial role in embryonic development and cellular differentiation. This protein is encoded by the HOXA10 gene and belongs to the homeobox family of transcription factors. Recombinant Human HOXA10 Protein is a highly conserved protein, with homologs found in various species including humans, mice, and zebrafish.

Structure of Recombinant Human HOXA10 Protein

Recombinant Human HOXA10 Protein is a 37 kDa protein composed of 343 amino acids. It contains a highly conserved DNA-binding domain known as the homeodomain, which is responsible for its transcriptional activity. This domain is composed of 60 amino acids and is characterized by three alpha helices, which form a helix-turn-helix structure. The homeodomain allows Recombinant Human HOXA10 Protein to bind to specific DNA sequences and regulate gene expression.

In addition to the homeodomain, Recombinant Human HOXA10 Protein also contains a C-terminal transactivation domain, which is responsible for its transcriptional activation function. This domain interacts with other transcription factors and co-regulators to activate the expression of target genes. Recombinant Human HOXA10 Protein also has a highly conserved N-terminal domain, which is important for its stability and nuclear localization.

Activity of Recombinant Human HOXA10 Protein

Recombinant Human HOXA10 Protein is a transcription factor that plays a critical role in regulating gene expression during embryonic development and cellular differentiation. It is primarily expressed in the developing reproductive tract, uterus, and ovaries, where it controls the expression of genes involved in uterine development and function. Recombinant Human HOXA10 Protein is also expressed in other tissues, such as the kidney, liver, and brain, where it has been shown to regulate cell proliferation and differentiation.

Studies have shown that Recombinant Human HOXA10 Protein is essential for the development of the female reproductive system. It regulates the expression of genes involved in uterine receptivity, embryo implantation, and pregnancy maintenance. In addition, Recombinant Human HOXA10 Protein has been found to play a role in the development of the male reproductive system, including the prostate and testes.

Furthermore, Recombinant Human HOXA10 Protein has been shown to have a crucial role in cancer development. Its expression has been found to be dysregulated in various cancers, including breast, ovarian, and prostate cancer. It has been suggested that Recombinant Human HOXA10 Protein may act as an oncogene by promoting cell proliferation and inhibiting apoptosis.

Application of Recombinant Human HOXA10 Protein

Recombinant Human HOXA10 Protein has numerous potential applications in both research and clinical settings. Its role in embryonic development and cellular differentiation makes it a valuable tool for studying reproductive biology and cancer development. Recombinant Human HOXA10 Protein can be used to investigate the molecular mechanisms underlying these processes and to identify potential therapeutic targets.

In addition, Recombinant Human HOXA10 Protein has potential clinical applications. Its role in uterine development and function makes it a promising candidate for the treatment of reproductive disorders, such as endometriosis and infertility. Recombinant Human HOXA10 Protein may also have potential as a biomarker for certain cancers, allowing for early detection and targeted treatment.

Conclusion

Recombinant Human HOXA10 Protein is a highly conserved transcription factor that plays a critical role in embryonic development and cellular differentiation. Its structure, activity, and potential applications make it a valuable tool for studying reproductive biology and cancer development. Further research on Recombinant Human HOXA10 Protein may lead to a better understanding of its role in these processes and the development of novel

Recombinant Human HOXA10 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HOXA10 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products