Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NSUN5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96P11
Molecular weight:
48.85 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Met1–Arg429
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NSUN5 Protein, N-His

Product name ARO-P11810-100
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429
Product name ARO-P11810-1MG
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429
Product name ARO-P11810-50
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429

Recombinant Human NSUN5 Protein: Structure, Activity, and Applications

Recombinant proteins are proteins that are produced in a laboratory setting through the use of genetic engineering techniques. These proteins have become essential tools in various fields of research and medicine due to their ability to mimic natural proteins and perform specific functions. One such recombinant protein is the Recombinant Human NSUN5 Protein, which has gained significant attention in recent years for its unique structure, activity, and potential applications.

Structure of Recombinant Human NSUN5 Protein

The NSUN5 gene encodes for a protein that belongs to the S-adenosylmethionine (SAM)-dependent methyltransferase family. The protein is composed of 296 amino acids and has a molecular weight of approximately 34 kDa. The recombinant form of NSUN5 is produced through the expression of the NSUN5 gene in a host cell, typically Escherichia coli (E. coli) or Chinese hamster ovary (CHO) cells.

The recombinant NSUN5 protein has a similar structure to its natural counterpart, with a conserved SAM-binding motif and a catalytic domain. However, recombinant NSUN5 may also have additional modifications, such as a His-tag or fusion with other proteins, to facilitate purification and enhance stability.

Activity of Recombinant Human NSUN5 Protein

The main activity of NSUN5 is its role as a methyltransferase, specifically targeting the 5-carbon position of cytosine residues in RNA molecules. This activity is crucial for the regulation of gene expression and has been linked to various cellular processes, including RNA processing, translation, and cell differentiation.

Recombinant NSUN5 has been shown to have similar enzymatic activity as the natural protein, with the ability to methylate specific RNA sequences in vitro. This activity has also been confirmed in vivo, where recombinant NSUN5 was able to rescue the loss of function of the endogenous protein in NSUN5-deficient cells.

Applications of Recombinant Human NSUN5 Protein

The unique structure and activity of Recombinant Human NSUN5 Protein make it a valuable tool in various applications. One of the primary uses of recombinant NSUN5 is in the study of RNA methylation and its role in gene expression. Recombinant NSUN5 can be used in in vitro assays to investigate the effects of RNA methylation on different cellular processes and identify potential therapeutic targets.

Additionally, recombinant NSUN5 has shown potential in the development of diagnostic tools for various diseases. Aberrant RNA methylation has been linked to several cancers, and recombinant NSUN5 can be used to detect and quantify these changes in RNA samples, providing a potential biomarker for cancer diagnosis and monitoring.

Moreover, recombinant NSUN5 has also been explored as a potential therapeutic target for cancer treatment. Inhibitors of NSUN5 have been developed, which can selectively block its methyltransferase activity and inhibit cancer cell growth. These inhibitors have shown promising results in pre-clinical studies and may have the potential to be developed into effective anti-cancer drugs.

Conclusion

In summary, Recombinant Human NSUN5 Protein is a valuable tool in the study of RNA methylation and its role in gene expression. Its unique structure and activity make it a versatile protein with potential applications in various fields, including research, diagnostics, and therapeutics. With ongoing studies and advancements in recombinant protein technology, the potential of NSUN5 and other recombinant proteins continues to expand, providing new insights and opportunities for scientific discovery and medical advancements.

Recombinant Human NSUN5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NSUN5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products