Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HBEGF, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99075
Molecular weight:
17.95 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Val21–Thr160
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HBEGF, N-His

Product name ARO-P13166-100
Uniprot ID Q99075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Molecular weight 17.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val21-Thr160
Aliases /Synonyms DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-P13166
Note For research use only.
Molecular Constructor
Val21–Thr160
Product name ARO-P13166-1MG
Uniprot ID Q99075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Molecular weight 17.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val21-Thr160
Aliases /Synonyms DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-P13166
Note For research use only.
Molecular Constructor
Val21–Thr160
Product name ARO-P13166-50
Uniprot ID Q99075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Molecular weight 17.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val21-Thr160
Aliases /Synonyms DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-P13166
Note For research use only.
Molecular Constructor
Val21–Thr160

Introduction

Recombinant Human HBEGF, also known as heparin-binding EGF-like growth factor, is a protein that plays a crucial role in cell growth, proliferation, and differentiation. It is a member of the epidermal growth factor (EGF) family and is produced through recombinant DNA technology. In this article, we will discuss the structure, activity, and application of Recombinant Human HBEGF.

Structure of Recombinant Human HBEGF

Recombinant Human HBEGF is a 22 kDa protein consisting of 148 amino acids. It contains a single EGF-like domain, a heparin-binding domain, and a transmembrane domain. The EGF-like domain is responsible for binding to the EGF receptor (EGFR) and activating downstream signaling pathways. The heparin-binding domain allows the protein to bind to heparin sulfate proteoglycans on the cell surface, facilitating its interaction with the EGFR. The transmembrane domain anchors the protein to the cell membrane. Recombinant Human HBEGF is glycosylated, meaning it has sugar molecules attached to it, which can affect its stability and activity.

Activity of Recombinant Human HBEGF

Recombinant Human HBEGF is a potent mitogen, meaning it stimulates cell growth and division. It does so by binding to the EGFR and activating signaling pathways such as the MAPK and PI3K pathways. These pathways regulate various cellular processes such as cell proliferation, survival, and differentiation. Recombinant Human HBEGF has also been shown to promote wound healing by stimulating the migration and proliferation of epithelial cells. In addition, it has anti-apoptotic effects, protecting cells from programmed cell death. The activity of Recombinant Human HBEGF is tightly regulated to maintain normal cellular functions, and dysregulation of its activity has been linked to various diseases.

Application of Recombinant Human HBEGF

Recombinant Human HBEGF has a wide range of applications in both research and clinical settings. In research, it is commonly used as a tool to study the role of HBEGF in various cellular processes. It can be used to stimulate cell growth or wound healing in cell cultures or animal models. In addition, it can be used to investigate the signaling pathways activated by HBEGF and their downstream effects. Recombinant Human HBEGF is also used in drug discovery and development, as it is a potential target for therapeutic intervention in diseases such as cancer and cardiovascular diseases.

In the clinic, Recombinant Human HBEGF has been studied for its potential use in wound healing and tissue regeneration. It has been shown to promote wound healing in animal models and is currently being investigated for its potential use in diabetic foot ulcers and other chronic wounds. In addition, Recombinant Human HBEGF has been studied for its potential use in cardiovascular diseases, as it has been shown to have protective effects on the heart and blood vessels.

Conclusion

Recombinant Human HBEGF is a highly versatile protein with important roles in cell growth, proliferation, and differentiation. Its structure, activity, and applications make it a valuable tool in both research and clinical settings. Further studies on the regulation and function of Recombinant Human HBEGF may lead to new insights and potential therapeutic interventions for various diseases.

Recombinant Human HBEGF, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HBEGF, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products