Brand: ProteoGenix

Recombinant Human GMFG Protein, N-His-SUMO

ARO-P11307-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: O60234
Molecular weight:: 28.61 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points

Val6–Arg142

Size Size

50ug Original price was: €285.00.Current price is: €230.00.
100ug Original price was: €415.00.Current price is: €329.00.
1MG Original price was: €1,193.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human GMFG Protein, N-His-SUMO

Product name	ARO-P11307-100
Uniprot ID	O60234
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Molecular weight	28.61 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val6-Arg142
Aliases /Synonyms	Glia maturation factor gamma, GMFG, GMF-gamma
Reference	ARO-P11307
Note	For research use only.
Molecular Constructor	Val6–Arg142

Product name	ARO-P11307-1MG
Uniprot ID	O60234
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Molecular weight	28.61 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val6-Arg142
Aliases /Synonyms	Glia maturation factor gamma, GMFG, GMF-gamma
Reference	ARO-P11307
Note	For research use only.
Molecular Constructor	Val6–Arg142

Product name	ARO-P11307-50
Uniprot ID	O60234
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Molecular weight	28.61 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val6-Arg142
Aliases /Synonyms	Glia maturation factor gamma, GMFG, GMF-gamma
Reference	ARO-P11307
Note	For research use only.
Molecular Constructor	Val6–Arg142