Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FBLN5, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UBX5
Molecular weight:
14.15 kDa

Original price was: €278.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Leu99–Cys205
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FBLN5, N-His

Product name ARO-P13035-100
Uniprot ID Q9UBX5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSC
Molecular weight 14.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu99-Cys205
Aliases /Synonyms UP50, Urine p50 protein, DANCE, Fibulin-5, Developmental arteries and neural crest EGF-like protein, Dance, FBLN5, FIBL-5
Reference ARO-P13035
Note For research use only.
Molecular Constructor
Leu99–Cys205
Product name ARO-P13035-1MG
Uniprot ID Q9UBX5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSC
Molecular weight 14.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu99-Cys205
Aliases /Synonyms UP50, Urine p50 protein, DANCE, Fibulin-5, Developmental arteries and neural crest EGF-like protein, Dance, FBLN5, FIBL-5
Reference ARO-P13035
Note For research use only.
Molecular Constructor
Leu99–Cys205
Product name ARO-P13035-50
Uniprot ID Q9UBX5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSC
Molecular weight 14.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu99-Cys205
Aliases /Synonyms UP50, Urine p50 protein, DANCE, Fibulin-5, Developmental arteries and neural crest EGF-like protein, Dance, FBLN5, FIBL-5
Reference ARO-P13035
Note For research use only.
Molecular Constructor
Leu99–Cys205

Introduction

Recombinant Human FBLN5, also known as Fibulin-5, is a protein that plays a crucial role in maintaining the structural integrity of tissues and organs. It is a member of the fibulin family of extracellular matrix proteins and is encoded by the FBLN5 gene. Recombinant Human FBLN5 is produced through genetic engineering techniques, making it a valuable tool in various research and medical applications.

Structure of Recombinant Human FBLN5

Recombinant Human FBLN5 is a 63 kDa protein consisting of 448 amino acids. It has a modular structure, with an N-terminal fibulin-type module, followed by 9 calcium-binding EGF-like domains and a C-terminal fibulin-type module. The fibulin-type modules are responsible for binding to other extracellular matrix proteins, while the EGF-like domains play a role in cell signaling and adhesion. The calcium-binding sites are crucial for the stability and function of the protein.

Activity of Recombinant Human FBLN5

Recombinant Human FBLN5 is primarily involved in maintaining the structural integrity of tissues and organs. It is a key component of elastic fibers, which are essential for the elasticity and resilience of tissues such as skin, blood vessels, and lungs. FBLN5 also plays a role in cell adhesion and migration, as well as regulating cell signaling pathways.

Studies have shown that FBLN5 deficiency can lead to various diseases and disorders, such as age-related macular degeneration, aortic aneurysms, and skin disorders. Recombinant Human FBLN5 has been used in research to better understand the role of this protein in these conditions and to develop potential treatments.

Application of Recombinant Human FBLN5

Recombinant Human FBLN5 has a wide range of applications in both research and medical fields. One of the primary uses of this protein is in studying the structure and function of elastic fibers. By producing recombinant FBLN5, researchers can study the effects of mutations or modifications on the protein’s activity and its role in various diseases.

In the medical field, Recombinant Human FBLN5 has shown promise as a potential therapeutic agent. Studies have demonstrated its ability to promote wound healing and tissue regeneration, making it a potential treatment for skin disorders and injuries. FBLN5 has also been investigated as a potential treatment for aortic aneurysms, as it has been found to improve the stability of the aortic wall and prevent further expansion of the aneurysm.

Conclusion

Recombinant Human FBLN5 is a crucial protein in maintaining the structural integrity of tissues and organs. Its modular structure and various functions make it a valuable tool in research and medical applications. By producing recombinant FBLN5, scientists can gain a better understanding of its role in various diseases and potentially develop new treatments. With ongoing research, the potential applications of Recombinant Human FBLN5 are continuously expanding, making it an important protein in the field of biotechnology.

Recombinant Human FBLN5, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FBLN5, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products