Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GABRB1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P18505
Molecular weight:
23.19 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Asp62–Asn242
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GABRB1 Protein, N-His

Product name ARO-P12058-100
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242
Product name ARO-P12058-1MG
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242
Product name ARO-P12058-50
Uniprot ID P18505
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRN
Molecular weight 23.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp62-Asn242
Aliases /Synonyms Gamma-aminobutyric acid receptor subunit beta-1, GABA(A) receptor subunit beta-1, GABRB1
Reference ARO-P12058
Note For research use only.
Molecular Constructor
Asp62–Asn242

Introduction

Recombinant Human GABRB1 Protein is a protein that plays a crucial role in the central nervous system as a component of the GABA-A receptor. This protein is encoded by the GABRB1 gene and is a member of the GABAA receptor subunit family. Recombinant Human GABRB1 Protein is produced through recombinant DNA technology and has a wide range of applications in both research and therapeutic fields.

Structure of Recombinant Human GABRB1 Protein

Recombinant Human GABRB1 Protein is a 45 kDa protein that consists of 409 amino acids. It has a typical structure of a GABA-A receptor subunit, with an extracellular N-terminus, four transmembrane domains, and an intracellular C-terminus. The protein has a conserved cysteine residue in the extracellular domain, which is important for disulfide bonding with other subunits of the GABA-A receptor.

Activity of Recombinant Human GABRB1 Protein

Recombinant Human GABRB1 Protein is a crucial component of the GABA-A receptor, which is a ligand-gated ion channel that mediates the inhibitory effects of the neurotransmitter GABA in the central nervous system. This protein forms a heteropentameric complex with other subunits of the GABA-A receptor, including GABRA1, GABRA2, GABRA3, and GABRA5. The binding of GABA to the GABA-A receptor causes conformational changes in the protein, leading to the opening of the ion channel and the influx of chloride ions into the cell. This hyperpolarization of the cell membrane results in the inhibition of neuronal activity, playing a crucial role in the regulation of neuronal excitability and maintaining the balance between excitation and inhibition in the brain.

Applications of Recombinant Human GABRB1 Protein

Recombinant Human GABRB1 Protein has a wide range of applications in both research and therapeutic fields. Here are some of its key applications:

1. Drug Development

The GABA-A receptor, including Recombinant Human GABRB1 Protein, is a target for many drugs used in the treatment of various neurological disorders, such as anxiety, epilepsy, and sleep disorders. Recombinant Human GABRB1 Protein can be used in drug screening assays to identify potential compounds that can modulate the activity of the GABA-A receptor and develop new treatments for these disorders.

2. Neuroscience Research

Recombinant Human GABRB1 Protein is a valuable tool for studying the structure and function of the GABA-A receptor. It can be used in biochemical and biophysical experiments to investigate the binding properties of GABA and other ligands to the receptor. It can also be used in electrophysiological studies to measure the activity of the receptor and its response to different stimuli.

3. Gene Therapy

Defects in the GABRB1 gene have been associated with certain neurological disorders, such as epilepsy and autism. Recombinant Human GABRB1 Protein can be used in gene therapy to replace the defective gene and restore the function of the GABA-A receptor, potentially providing a new treatment option for these disorders.

4. Antibody Production

Recombinant Human GABRB1 Protein can be used as an antigen to produce specific antibodies that can be used in various assays, such as Western blotting and immunohistochemistry, to detect the expression of GABRB1 in different tissues and cells. These antibodies can also be used to study the distribution and localization of GABRB1 in the brain.

5. Neuroscience Education

Recombinant Human GABRB1

Recombinant Human GABRB1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GABRB1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products