Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FOXP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H334
Molecular weight:
26.04 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Asn461–Pro671
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FOXP1, N-His

Product name ARO-P13109-100
Uniprot ID Q9H334
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEP
Molecular weight 26.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn461-Pro671
Aliases /Synonyms FOXP1, MFH, Forkhead box protein P1, Mac-1-regulated forkhead
Reference ARO-P13109
Note For research use only.
Molecular Constructor
Asn461–Pro671
Product name ARO-P13109-1MG
Uniprot ID Q9H334
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEP
Molecular weight 26.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn461-Pro671
Aliases /Synonyms FOXP1, MFH, Forkhead box protein P1, Mac-1-regulated forkhead
Reference ARO-P13109
Note For research use only.
Molecular Constructor
Asn461–Pro671
Product name ARO-P13109-50
Uniprot ID Q9H334
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEP
Molecular weight 26.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn461-Pro671
Aliases /Synonyms FOXP1, MFH, Forkhead box protein P1, Mac-1-regulated forkhead
Reference ARO-P13109
Note For research use only.
Molecular Constructor
Asn461–Pro671

Introduction to Recombinant Human FOXP1

Recombinant Human FOXP1 is a protein that plays a crucial role in the development and function of various tissues and organs in the human body. It belongs to the family of forkhead box (FOX) transcription factors, which are known to regulate gene expression and control cellular processes such as cell growth, differentiation, and survival. FOXP1 is highly conserved among different species, indicating its essential role in biological processes.

Structure of Recombinant Human FOXP1

The human FOXP1 gene is located on chromosome 3p13 and consists of 21 exons. The full-length protein is composed of 677 amino acids and has a molecular weight of approximately 75 kDa. FOXP1 contains a DNA-binding domain, a transcriptional repression domain, and a protein-protein interaction domain. These domains allow FOXP1 to bind to specific DNA sequences and regulate gene expression by interacting with other proteins.

Recombinant Human FOXP1 is produced through genetic engineering techniques, where the human FOXP1 gene is inserted into a suitable expression vector and then expressed in a host organism such as E. coli or mammalian cells. This allows for the production of large quantities of pure and functional FOXP1 protein for various research and therapeutic applications.

Activity of Recombinant Human FOXP1

FOXP1 is mainly expressed in the brain, heart, lung, and immune cells, and has been found to play a crucial role in the development and function of these tissues. It acts as a transcription factor by binding to specific DNA sequences and regulating the expression of target genes. FOXP1 has been shown to regulate the development of the central nervous system, heart, and lungs, as well as the differentiation and function of immune cells.

Moreover, FOXP1 has been linked to several diseases, including cancer. It has been found to act as a tumor suppressor in some cancers, while in others, it promotes tumor growth and metastasis. Studies have also shown that mutations in the FOXP1 gene are associated with neurodevelopmental disorders and autoimmune diseases.

Applications of Recombinant Human FOXP1

Recombinant Human FOXP1 has a wide range of applications in both research and therapeutic settings. Its ability to regulate gene expression makes it a valuable tool for studying the development and function of various tissues and organs. It can also be used to investigate the role of FOXP1 in different diseases, including cancer, neurodevelopmental disorders, and autoimmune diseases.

Furthermore, FOXP1 has potential therapeutic applications. As a tumor suppressor, it can be used in cancer therapy to inhibit tumor growth and metastasis. On the other hand, as a promoter of tumor growth, it can be targeted for cancer treatment by inhibiting its activity. FOXP1 has also been found to regulate immune responses, making it a potential target for the treatment of autoimmune diseases.

In addition, recombinant FOXP1 protein can be used as an antigen in the production of antibodies for research and diagnostic purposes. Antibodies against FOXP1 can be used to study its expression and localization in different tissues and diseases, as well as to develop diagnostic tests for FOXP1-related disorders.

Conclusion

In summary, Recombinant Human FOXP1 is a crucial protein involved in the development and function of various tissues and organs. Its structure, activity, and potential applications make it a valuable tool for research and a potential target for therapeutic interventions. Further studies on FOXP1 will provide a better understanding of its role in health and disease, leading to the development of novel treatments for various disorders.

Recombinant Human FOXP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FOXP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products